DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl6

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_955826.1 Gene:elovl6 / 317738 ZFINID:ZDB-GENE-030114-1 Length:266 Species:Danio rerio


Alignment Length:244 Identity:67/244 - (27%)
Similarity:114/244 - (46%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVKVLGPK-LMENRKPFELRKVLIVYNAAQVIFSAWLFYESCIGGWLNGYNLR-------CEPV 100
            |...:||.: :|:.|:.|||||.|::::.....||  :|.....||::....:.       |:..
Zfish    38 YAACILGGRHVMKQREKFELRKPLVLWSLTLAAFS--IFGAIRTGGYMVNILMTKGLKQSVCDQS 100

  Fly   101 NYSYSPKAIRTAEGCWWYYF--SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVK-F 162
            .|: .|     ....|.|.|  ||..|..||.|.|:||:  ::..||..||..:.:..|:..| .
Zfish   101 FYN-GP-----VSKFWAYAFVLSKAPELGDTLFIVLRKQ--KLIFLHWYHHITVLLYSWYSYKDM 157

  Fly   163 TPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFF-- 225
            ..||  .:|..:|..||..||:||.|.|.|.|:.:.  :..::|:.|:.|.|:..|.::.::.  
Zfish   158 VAGG--GWFMTMNYLVHAVMYSYYALRAAGFKISRK--FAMFITLTQITQMVMGCVVNYLVYLWM 218

  Fly   226 --KNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYV-KRDGKDKASVKA 271
              ..:|...:....:.....:.::.||..|:..||: ||  |..|:.|:
Zfish   219 QQGQECPSHVQNIVWSSLMYLSYFVLFCQFFFEAYITKR--KSNAAKKS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 65/237 (27%)
elovl6NP_955826.1 ELO 23..261 CDD:279492 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.