DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elovl4

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:286 Identity:120/286 - (41%)
Similarity:176/286 - (61%) Gaps:12/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYE 83
            :|.|..|:|||.||:||::||..|...| .||||.|::|:||::|.|||:||...|:.:.::|.|
  Rat    33 ADKRVEDWPLMQSPWPTLSISTLYLLFV-WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRE 96

  Fly    84 SCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIH 148
            ..:|.:..||:..|:.|:||.....:|.|...|||:.||..|:.||.||::||:.:|||.|||.|
  Rat    97 LFMGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYH 161

  Fly   149 HGIMPVSVWW-GVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQ 212
            |..| .::|| |:|:..||.:.|...:|:|:|:.||:||.|.|.||.:|||||||:|||::|::|
  Rat   162 HCTM-FTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQ 225

  Fly   213 FVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKANG-HAN 276
            |.:.:.|: .|....||.:|....:.:.|:|:.|.|||.|||.|.|.:...........|| .||
  Rat   226 FHVTIGHT-ALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKKSKTGKTATNGISAN 289

  Fly   277 GHVKA-----LKDGDVAPTSNGQANG 297
            |..|:     |::|  .|..||:..|
  Rat   290 GVNKSEKQLVLENG--KPQKNGKPKG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 105/239 (44%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 105/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.