DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elovl3

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001101072.1 Gene:Elovl3 / 309449 RGDID:1307263 Length:271 Species:Rattus norvegicus


Alignment Length:249 Identity:67/249 - (26%)
Similarity:104/249 - (41%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFS------AWLFYESCIGGWLNGYNLR 96
            |.|.|..:: :.|...|:.||.|.|::.||:::....|||      .|.|    :|..|....|:
  Rat    41 IVLVYLLLI-IFGQNYMKTRKGFSLQRPLILWSFCLAIFSILGTLRMWKF----MGTVLFTMGLK 100

  Fly    97 CEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVK 161
            .......|:..|| .....|.:..||..|..||.|.::|||  .:..:|..||..:.:...:|.|
  Rat   101 QTVCFTDYTNDAI-VKFWSWVFLLSKVVELGDTAFIILRKR--PLIFVHWYHHSTVLLFTSFGYK 162

  Fly   162 -FTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFF 225
             ..|.|  .:|..:|..||..||.||.:.|...|....|  ...:|.:|::|.||..:.....:.
  Rat   163 NKVPSG--GWFMTMNLGVHSVMYTYYTMKAAKVKHPNIL--PMVITSLQILQMVLGTIFGILNYI 223

  Fly   226 ---KNDCNYPIGFAYFIGAHAV-------MFYFLFSNFYKRAYV--KRDGKDKA 267
               :..|       |....|..       .::.||:.|:.|||:  ||..:.|:
  Rat   224 WRQERGC-------YTTSEHFFWSFVLYGTYFILFAQFFHRAYLRPKRKAESKS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 66/246 (27%)
Elovl3NP_001101072.1 ELO 30..266 CDD:279492 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.