DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elo-8

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001255110.1 Gene:elo-8 / 259739 WormBaseID:WBGene00001246 Length:292 Species:Caenorhabditis elegans


Alignment Length:324 Identity:71/324 - (21%)
Similarity:117/324 - (36%) Gaps:87/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SPFPTIAISLTYAYIVKVLGPKLMENRK----------PFEL-RKVLIVYNAAQVIFSAWLFYES 84
            |..|...:.:.|.::.....|..:.:|.          .|:| ..:|::........|.| .|..
 Worm    14 SLLPIHLLGIFYVFVAFNFRPSHISDRSYLKEWYYYNCVFQLGLGILMIPEILTSSLSGW-HYSV 77

  Fly    85 CIGGWL-NGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYD--QVSTLHV 146
            |..|.| .|:        :|.|..||.|        |:|..:..:|...:    ||  :..|:|:
 Worm    78 CHSGTLYTGF--------FSGSVVAIWT--------FTKVVDLLETMLLL----YDARRPLTIHI 122

  Fly   147 IHHGIMPVSVWWGVKFTPGGHSTFFG------FLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYL 205
            |||       :..:.|....:|..|.      |.|...|:|:|||    ..|.|:.. .|...::
 Worm   123 IHH-------FLSLSFAFTFYSQNFALHRWIVFFNLTAHVFLYAY----LSGFKILN-RWTPCWV 175

  Fly   206 TV--MQMIQFVLVMVHSFQLFFK------NDCN------YPIGFAYFIGAHAVMFYFLFSNFY-- 254
            .|  .||:|.:|..:.:|....|      .|.|      ..||....|        .||:.||  
 Worm   176 AVCSSQMLQLILPFIATFSAAAKLARGTRCDANALGLLTLQIGLGVLI--------ILFAEFYWS 232

  Fly   255 -KRAYVKRDGKDKASVKANGHANGH-----VKALKDGDVAPTSNGQANGFHNTFSKFTTDMCNP 312
             .:|:.|::.|......:|..::..     :|.||    |...:.:...|.|.|.:..:.:.:|
 Worm   233 RVQAFRKKNMKSGGGGTSNSDSSEQESEKVLKKLK----ARRPSDETVMFENDFPELRSVIFSP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 62/271 (23%)
elo-8NP_001255110.1 ELO 14..243 CDD:295675 61/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.