DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and CG30008

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:252 Identity:82/252 - (32%)
Similarity:125/252 - (49%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYESCIGG---- 88
            :...|:..|.:.:.|.|.|...||..||.|||:||:::::::|..||:        |||..    
  Fly    18 IYKDPWYMITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQVV--------SCIYAIKEV 74

  Fly    89 -----------WLNGYNLRCEPVNYSYSPKAIRTAEG-CWWYYFSKFTEFFDTFFFVMRKRYDQV 141
                       |      :|..:  ..||:.:|.... .::.::.|.:|..:|..||:||:.:||
  Fly    75 LYITDNTIYIFW------KCRDI--GSSPELVRRYYNLAYFLFWLKISELIETVIFVLRKKQNQV 131

  Fly   142 STLHVIHHGIMPVSVWWGVKFTPGGHSTFF-GFLNTFVHIFMYAYYMLAAMGPK--VQKYLWWKK 203
            |.||:.||......|:..:.|...|.:.:| .|||:.||:.||:||.:||:..|  ||.....||
  Fly   132 SKLHIFHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTPVKK 196

  Fly   204 YLTVMQMIQFVLVMVH-SFQLFFKNDCNY-PIGFAYFIGAHAVMFYFLFSNFYKRAY 258
            .:||:||.||||::.. :|||..   |.. |:...||......|||. |.:||..||
  Fly   197 CITVIQMTQFVLILTQVAFQLVL---CGMPPLVLLYFTTVILGMFYG-FYDFYNSAY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 82/252 (33%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 82/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449626
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.