DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elo-7

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001255397.1 Gene:elo-7 / 186426 WormBaseID:WBGene00001245 Length:309 Species:Caenorhabditis elegans


Alignment Length:278 Identity:78/278 - (28%)
Similarity:128/278 - (46%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WRDLMDNKSD--PRTRDYPLMSSPFPTIAISLTYAYIVKVLGPK-LMENRKPFELRKVLIVYNAA 72
            | .|:.|:.:  |..|....:...| .:.:.:..||::.|...| .|.:|:||:|...|.::|..
 Worm    43 W-SLLTNQDEVFPHIRARRFIQEHF-GLFVQMAIAYVILVFSIKRFMRDREPFQLTTALRLWNFF 105

  Fly    73 QVIFSAWLFYESCIGGW-----------LNG-YNLRCEPVNYSYSPKAIRTAEGCWWYY---FSK 122
            ..:||.:       |.|           |.| |...||.:  |..|     ::..:|.:   .||
 Worm   106 LSVFSIY-------GSWTMFPFMVQQIRLYGLYGCGCEAL--SNLP-----SQAEYWLFLTILSK 156

  Fly   123 FTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVKF-TPGGHSTFFGFLNTFVHIFMYAYY 186
            ..||.||||.|:||:  .:..||..||  |...|::...: ||...|.....:|.|||.|||.||
 Worm   157 AVEFVDTFFLVLRKK--PLIFLHWYHH--MATFVFFCSNYPTPSSQSRVGVIVNLFVHAFMYPYY 217

  Fly   187 MLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFF-----KNDCNYPIGFAYFIGAHAVMF 246
            ...:|..||...:  ...:||:|:.||:..:.....:::     :..|:.|:...:...|.:..:
 Worm   218 FTRSMNIKVPAKI--SMAVTVLQLTQFMCFIYGCTLMYYSLATNQYTCDTPMFVLHSTFALSSSY 280

  Fly   247 YFLFSNFYKRAYVKRDGK 264
            :.||:||:.:||::|.||
 Worm   281 FVLFANFFHKAYLQRGGK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 73/260 (28%)
elo-7NP_001255397.1 ELO 61..299 CDD:279492 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.