DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elovl6

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:247 Identity:68/247 - (27%)
Similarity:108/247 - (43%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GPKLMENRKPFELRKVLIVYNAAQVIFS--------AWLFY---------ESCIGGWLNGYNLRC 97
            |..||..|..|||||.|::::....:||        |::.|         ..|...:.||     
  Rat    47 GRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNG----- 106

  Fly    98 EPVNYSYSPKAIRTAEGCWWYYF--SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGV 160
             ||:            ..|.|.|  ||..|..||.|.::||:  ::..||..||..:.:..|:..
  Rat   107 -PVS------------KFWAYAFVLSKAPELGDTIFIILRKQ--KLIFLHWYHHITVLLYSWYSY 156

  Fly   161 K-FTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVLVMVHSFQLF 224
            | ...||  .:|..:|..||..||:||.|.|.|.:|.:.  :..::|:.|:.|.::..|.::.:|
  Rat   157 KDMVAGG--GWFMTMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLSQITQMLMGCVINYLVF 217

  Fly   225 ----FKND-CNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKA 271
                ..|| |.......::.....:.:..||.:|:..||:   ||.|.:.||
  Rat   218 NWMQHDNDQCYSHFQNIFWSSLMYLSYLLLFCHFFFEAYI---GKVKKATKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 65/240 (27%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.