DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and Elovl5

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:290 Identity:111/290 - (38%)
Similarity:164/290 - (56%) Gaps:18/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYES 84
            |.|.:.:.|:.:..||...|..|..|| .||||.|:||:||..|.:|:|||....:.|.::|||.
  Rat    20 DTRVKGWFLLDNYIPTFVCSAIYLLIV-WLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYEL 83

  Fly    85 CIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLHVIHH 149
            ..|.|...||..|:... |.....::.....|||||||..||.|||||::||...|::.|||.||
  Rat    84 VTGVWEGKYNFFCQGTR-SAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHH 147

  Fly   150 GIMPVSVWWGV-KFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQF 213
            ..| :::||.| .:.|.|||.|...||:|:|:.||:||.|::: |.::.|||||||:|..|::||
  Rat   148 ATM-LNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLVQF 210

  Fly   214 VLVMVH-SFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDKASVKANGHANG 277
            ||.::. |..:.:  .|::|:|:.||...:.:....||:|||.:.|.|: |..:......||.||
  Rat   211 VLTIIQTSCGVIW--PCSFPLGWLYFQIGYMISLIALFTNFYIQTYNKK-GASRRKEHLKGHQNG 272

  Fly   278 HVKALKDGDVAPTSNGQANGFHNTFSKFTT 307
            .:.|:         ||..|.|.:..:..|:
  Rat   273 SMTAV---------NGHTNNFASLENSVTS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 99/240 (41%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 99/240 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.