DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl3

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_002935809.1 Gene:elovl3 / 100497108 XenbaseID:XB-GENE-977704 Length:270 Species:Xenopus tropicalis


Alignment Length:254 Identity:76/254 - (29%)
Similarity:121/254 - (47%) Gaps:54/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSAWLFYESCIG----GWL-------NG 92
            ||.||.:: ..|.::|:.|:.||||:.|::::....:|       |.||    ||.       ||
 Frog    43 SLLYAALI-FGGQRMMKERRRFELRRPLVLWSFTLAVF-------SIIGAVRTGWFMGNILITNG 99

  Fly    93 YNLR-CEPVNYSYSPKAIRTAEGCWWYYF--SKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPV 154
            :... |:...|| .|     ....|.|.|  ||..|..||.|.|:||:  ::..||..||..:.:
 Frog   100 FKQSVCDRAFYS-GP-----VSKFWAYAFVLSKVPELGDTLFIVLRKQ--KLIFLHWYHHITVLL 156

  Fly   155 SVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQKYLWWKKYLTVMQMIQFVL-VMV 218
            ..|:..|.|..| ..:|..:|..||.|||:||.|.|.|.:|.:..  ..::|..|::|.|: ::|
 Frog   157 YTWYTYKDTVAG-GGWFMTMNYTVHAFMYSYYTLRAAGIRVPRPC--AMFITFTQILQMVMGIVV 218

  Fly   219 HSFQLFFKND--C---------NYPIGFAYFIGAHAVMFYFLFSNFYKRAYVKRDGKDK 266
            ::....::.|  |         :..:.|:|||         ||.:|:.:||:|...|:|
 Frog   219 NALVYSWRQDGSCLSTTENIFWSCLMYFSYFI---------LFCSFFYKAYLKYPIKNK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 75/252 (30%)
elovl3XP_002935809.1 ELO 31..262 CDD:366492 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.