DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL and elovl6l

DIOPT Version :9

Sequence 1:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:232 Identity:62/232 - (26%)
Similarity:105/232 - (45%) Gaps:30/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVKVLGPK-LMENRKPFELRKVLIVYNAAQVIFS--------AWLFYESCIGGWLNGYNLRCEP 99
            |:|.|.|.: .|::|:..:|||||::::.:..|||        .::.|.....|:....   |:.
Zfish    42 YVVLVFGGQHFMKDRQRLDLRKVLMMWSLSLAIFSIIGAVRTGCFMLYILSTSGFKQSV---CDQ 103

  Fly   100 VNYSYSPKAIRTAEGCWW---YYFSKFTEFFDTFFFVMRKRYDQVSTLHVIHHGIMPVSVWWGVK 161
             ::.|.|.:      .:|   :..||..|..||.|.|:||:  ::..||..||..:.|..|:..|
Zfish   104 -SFYYGPIS------KFWACAFVLSKAPELGDTMFIVLRKQ--RLIFLHWYHHITVLVYSWYSYK 159

  Fly   162 FTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQK---YLWWKKYLTVMQMIQFVLVMVHSFQL 223
            ....| ..:|..:|..||..||:||...|.|.:|.|   .|.....:..|.|...|..:|:.:..
Zfish   160 DQVAG-GGWFMTMNYTVHALMYSYYAARAAGLRVPKPCAILITSSQIAQMAMDLAVSALVYRWMQ 223

  Fly   224 FFKNDCNYPIGFAYFIGAHAVMFYFLFSNFYKRAYVK 260
              ..||...:....:.....:.:..|||:|:.::|:|
Zfish   224 --DGDCPSYLDNIVWASLMYLSYLLLFSSFFYQSYMK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVLNP_649754.1 ELO 27..266 CDD:366492 62/232 (27%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 62/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.