DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD98hc and AMY2

DIOPT Version :9

Sequence 1:NP_001262354.2 Gene:CD98hc / 40941 FlyBaseID:FBgn0037533 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001323338.1 Gene:AMY2 / 843945 AraportID:AT1G76130 Length:413 Species:Arabidopsis thaliana


Alignment Length:356 Identity:65/356 - (18%)
Similarity:113/356 - (31%) Gaps:112/356 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EEKIKHLVALYQGSDTRVILDLTPNYAAKNSQ------LVQDAIANPEKRSAFVWVSGGKALPNN 288
            |..:|.|:...:....|.:.|:..|:....::      ...|.|:.|....|....:||.     
plant    89 EHLLKSLLRKMKQYKVRAMADIVINHRVGTTRGHGGMYNRYDGISLPWDEHAVTSCTGGL----- 148

  Fly   289 WLKVGGNRSAWEKVGDNYVLSQFEDGYYDLKMNSTIIRNEFGAVLKHL-VALGVRGFRLKNTKFF 352
                 ||||    .|||:      :|..::......:|.:....|:.| ..:|.:.||....:.:
plant   149 -----GNRS----TGDNF------NGVPNVDHTQHFVRKDIIGWLRWLRNTVGFQDFRFDFARGY 198

  Fly   353 ALFDSLEDEQISSSPKDFSLGP-----------NEYGFYSHRQ--TTFLSGLGDVLYDYLSIVKN 404
            :.  :...|.|.::...||:|.           .:|...||||  .:::...|.        :..
plant   199 SA--NYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQRIISWIDATGQ--------ISA 253

  Fly   405 ASDEAFFSVAEDVMEPQVYQLSGDSGAYGIDLPMYGNFVKVLSKSKPDTSLQKELDNTLAQSGTD 469
            |.|.....:.::.::.|.::|....|                   ||              .|..
plant   254 AFDFTTKGILQEAVKGQYWRLCDAQG-------------------KP--------------PGVM 285

  Fly   470 SWLQW-NLADVYVDTPQDPSALA-------------MFLSLLPGVPVVAVDAVAYQNVTEETYRQ 520
            .|  | :.|..::|.....|..|             .::...||:|.|..|  .:.:.....:.|
plant   286 GW--WPSRAVTFLDNHDTGSTQAHWPFPSHHVMEGYAYILTHPGIPCVFYD--HFYDWGSSIHDQ 346

  Fly   521 ITSL-----------RKTASYMHGNLNLYQA 540
            |..|           |.|...:....|||.|
plant   347 IVKLIDIRRRQDIHSRSTVRVLKAESNLYAA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD98hcNP_001262354.2 AmyAc_maltase-like 117..593 CDD:200468 65/356 (18%)
AMY2NP_001323338.1 PLN02361 15..413 CDD:177990 65/356 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43447
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.