DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD98hc and AMY3

DIOPT Version :9

Sequence 1:NP_001262354.2 Gene:CD98hc / 40941 FlyBaseID:FBgn0037533 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_564977.1 Gene:AMY3 / 843319 AraportID:AT1G69830 Length:887 Species:Arabidopsis thaliana


Alignment Length:472 Identity:93/472 - (19%)
Similarity:162/472 - (34%) Gaps:165/472 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 RGPHAKFASVETCRPEDVQVAKKLV-------SAGAIYELPAALTYDVKKPEVEEK--------- 232
            |...:..|.|||.:.:|| :.|::.       :.|.||         |:..||:||         
plant    65 RATSSDTAVVETAQSDDV-IFKEIFPVQRIEKAEGKIY---------VRLKEVKEKNWELSVGCS 119

  Fly   233 -----IKHLVALYQGSDTRVILDLTP-NYAAKNSQLVQD-AIANPEKRSAFVWVSGGKALPNNWL 290
                 |.|....|.| ||....|..| :.....|..::| ||..|.|:     :|.|    :::.
plant   120 IPGKWILHWGVSYVG-DTGSEWDQPPEDMRPPGSIAIKDYAIETPLKK-----LSEG----DSFF 174

  Fly   291 KVGGNRSAWEKVGD-NYVLSQFEDGYY--------------DLKMNSTII--RNEFGAVLKHLVA 338
            :|..|.:....|.. |:||...|.|.:              |:..|..:|  :..||       |
plant   175 EVAINLNLESSVAALNFVLKDEETGAWYQHKGRDFKVPLVDDVPDNGNLIGAKKGFG-------A 232

  Fly   339 LG-VRGFRLKNTKFFALFDSLEDEQISSSPKDFSLGPNEYGFYSHRQTTFLSGLGDVLYDYLSIV 402
            || :....||..|..|..||:|:.:          |..|:                  |:.:.|.
plant   233 LGQLSNIPLKQDKSSAETDSIEERK----------GLQEF------------------YEEMPIS 269

  Fly   403 KNASDEAFFSV--------AEDVMEPQVYQLSGD---------SGAYGIDLPM--YGNFVKVLSK 448
            |..:|:...||        :::::..:. .|.||         :|....::|.  |.....:...
plant   270 KRVADDNSVSVTARKCPETSKNIVSIET-DLPGDVTVHWGVCKNGTKKWEIPSEPYPEETSLFKN 333

  Fly   449 SKPDTSLQKE-----------LDNTL------AQSGTDSWLQWNLADVYV--------------- 481
            ....|.||::           ||..|      .:...::||.:...|.||               
plant   334 KALRTRLQRKDDGNGSFGLFSLDGKLEGLCFVLKLNENTWLNYRGEDFYVPFLTSSSSPVETEAA 398

  Fly   482 -------DTPQDPSALAMFLSLLPGVPVVAVDAVAYQNVTEETYRQITSLRKTASYMHGNLNLYQ 539
                   .|.::.||......::..:..:|:|..:::|       |.|::::....:...:....
plant   399 QVSKPKRKTDKEVSASGFTKEIITEIRNLAIDISSHKN-------QKTNVKEVQENILQEIEKLA 456

  Fly   540 ADPLVAFSRIKSGNPGY 556
            |:   |:|..:|..|.:
plant   457 AE---AYSIFRSTTPAF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD98hcNP_001262354.2 AmyAc_maltase-like 117..593 CDD:200468 93/472 (20%)
AMY3NP_564977.1 PLN02784 1..887 CDD:215419 93/472 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43447
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.