DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD98hc and Amy-p

DIOPT Version :9

Sequence 1:NP_001262354.2 Gene:CD98hc / 40941 FlyBaseID:FBgn0037533 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001286518.1 Gene:Amy-p / 47764 FlyBaseID:FBgn0000079 Length:494 Species:Drosophila melanogaster


Alignment Length:444 Identity:84/444 - (18%)
Similarity:141/444 - (31%) Gaps:136/444 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EEKIKHLVALYQGSDTRVILDLTPNYAAKNSQLVQDAIANPEKRSAFVWVSGGKALPNNWLKVGG 294
            ||:...:|........|..:|:..|:.|.:              .......|..|.|::....|.
  Fly    92 EEQFASMVKRCNAVGVRTYVDVVFNHMAAD--------------GGTYGTGGSTASPSSKSYPGV 142

  Fly   295 NRSAWEKVGDNYVLSQFED----------GYYDLKMNSTIIRNEFGAVLKHLVALGVRGFRLKNT 349
            ..|:.: ......:|.:.|          |..||...::.::::....|.||:.|||.|||:...
  Fly   143 PYSSLD-FNPTCAISNYNDANEVRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAA 206

  Fly   350 KFF------ALFDSLE----DEQISSSPKDF-----------SLGPNEY-GFYSHRQTTFLSGLG 392
            |..      .::..|:    |...:|..|.:           ::..:|| |..:..:......:|
  Fly   207 KHMWPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAISKSEYTGLGAITEFRHSDSIG 271

  Fly   393 DVL--YDYLSIVKN--------ASDEAFFSVAEDVMEPQVYQLSGDSGAYGIDLPMYGNFVKVLS 447
            .|.  .|.|..:.|        |||.:...|..       :......||.|.|         ||:
  Fly   272 KVFRGKDQLQYLTNWGTAWGFAASDRSLVFVDN-------HDNQRGHGAGGAD---------VLT 320

  Fly   448 KSKPDTSLQKELDNTLAQSGTDSWLQWNLADVYV-----DTPQDPSALAMFLSLLPGVPV----- 502
            ...|.                    |:.:|..::     .||:..|:.: |.....|.|.     
  Fly   321 YKVPK--------------------QYKMASAFMLAHPFGTPRVMSSFS-FTDTDQGPPTTDGHN 364

  Fly   503 VAVDAVAYQN------VTEETYRQI---TSLRKTASYMHGNLNLYQ-----ADPLVAFSRIKSGN 553
            :|.......|      |.|..:|||   .:.|.|.     .|:..|     ....::|||   |:
  Fly   365 IASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNTV-----GLDEIQNWWDNGSNQISFSR---GS 421

  Fly   554 PGYFVIFNPTELPQASNFTIPDNLPDKMTVSYFSEQYNNNMDNS---GKVAHAG 604
            .| ||.||      ..|:.:..:|...:....:.:..:.:...|   ||....|
  Fly   422 RG-FVAFN------NDNYDLNSSLQTGLPAGTYCDVISGSKSGSSCTGKTVTVG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD98hcNP_001262354.2 AmyAc_maltase-like 117..593 CDD:200468 80/428 (19%)
Amy-pNP_001286518.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 66/358 (18%)
Alpha-amylase 54..342 CDD:278554 52/300 (17%)
Aamy_C 405..493 CDD:214749 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43447
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.