DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD98hc and Amy1a

DIOPT Version :9

Sequence 1:NP_001262354.2 Gene:CD98hc / 40941 FlyBaseID:FBgn0037533 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001010970.1 Gene:Amy1a / 24203 RGDID:2113 Length:521 Species:Rattus norvegicus


Alignment Length:419 Identity:94/419 - (22%)
Similarity:147/419 - (35%) Gaps:119/419 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EEKIKHLVALYQGSDTRVILDLTPNY-----AAKNSQLVQDAIANPEKR-------SAFVWVSGG 282
            |::.:.:|........|:.:|...|:     |.........:..||..|       |.|.: :.|
  Rat   101 EDEFRDMVNRCNNVGVRIYVDAVINHMCGVGAEAGQSSTCGSYFNPNNRDFPGVPYSGFDF-NDG 164

  Fly   283 KALPNNWLKVGGNRSAWEKVGDNY-VLSQFED----GYYDLKMNSTIIRNEFGAVLKHLVALGVR 342
            |.      |.|....      :|| ..:|..|    |..||.:....:|.:....:.||:.:||.
  Rat   165 KC------KTGSGGI------ENYNDAAQVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVA 217

  Fly   343 GFRLKNTKFF------ALFDSLED---EQISSSPKDF-----------SLGPNEYGFYSHRQTTF 387
            ||||..:|..      |:.|.|.:   :..|...|.|           ::..||| |.:.|.|.|
  Rat   218 GFRLDASKHMWPGDIKAVLDKLHNLNTKWFSEGSKPFIYQEVIDLGGEAVSSNEY-FGNGRVTEF 281

  Fly   388 LSG--LGDVLYDY----LSIVKN--------ASDEAFFSVAEDVMEPQVYQLSGDSG-------- 430
            ..|  ||.||..:    ::.:||        .||.|...|  |..:.|....:|.|.        
  Rat   282 KYGAKLGKVLRKWDGEKMAYLKNWGEGWGFMPSDRALVFV--DNHDNQRGHGAGGSSILTFWDAR 344

  Fly   431 ----AYGIDLPMYGNFVKVLSKSKPDTSLQKELDNTLAQSGTDSWLQW--NLADV--YVDTPQDP 487
                |.|..|.....|.:|:|                    :..|.::  |..||  :|..|.:.
  Rat   345 LYKMAVGFMLAHPYGFTRVMS--------------------SFHWPRYFENGKDVNDWVGPPNNN 389

  Fly   488 SALAMFLSLLPGVPVVAVDAVAYQNVTEETYRQITSLRKTASYMHGN--LNLY-QADPLVAFSRI 549
            .|       ...|.:.:........|.|..:|||.::....:.::|.  .|.: .....|||.| 
  Rat   390 GA-------TKEVTINSDSTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFGR- 446

  Fly   550 KSGNPGYFVIFNPTELPQASNFTIPDNLP 578
              ||.| |::||..:...::  |:...||
  Rat   447 --GNKG-FIVFNNDDWDLST--TLQTGLP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD98hcNP_001262354.2 AmyAc_maltase-like 117..593 CDD:200468 94/419 (22%)
Amy1aNP_001010970.1 AmyAc_bac_euk_AmyA 35..426 CDD:200456 79/367 (22%)
AmyA 56..>325 CDD:223443 57/239 (24%)
Aamy_C 432..520 CDD:214749 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.