DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrtc2

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_017167796.1 Gene:Dmrtc2 / 71241 MGIID:1918491 Length:401 Species:Mus musculus


Alignment Length:103 Identity:44/103 - (42%)
Similarity:53/103 - (51%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGGASSSS-------GSSISPRTP----PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTAD 78
            |...||.:       .:.:.||.|    |.||||||||:...||||||.|.|:.|.|.||.|..:
Mouse    43 CSADSSPADEARVPQSTELIPRRPVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILE 107

  Fly    79 RQRVMALQTALRRAQAQDEQRALHMHEVPPANPAATTL 116
            |:||||.|.||||.|....:|.|....:..|.|....|
Mouse   108 RRRVMAAQVALRRQQEAQLKRHLAQGLMKGATPLKAPL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 28/48 (58%)
DSX_dimer 353..404 CDD:285978
Dmrtc2XP_017167796.1 DM 69..115 CDD:366283 27/45 (60%)
DMRT-like 273..400 CDD:374115
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.