DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrtc1c1

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_006528348.1 Gene:Dmrtc1c1 / 71083 MGIID:1918333 Length:254 Species:Mus musculus


Alignment Length:188 Identity:44/188 - (23%)
Similarity:63/188 - (33%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 TALRSPPHSDHGG-SVGPATSSSGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRSSG 294
            |.||:....|... |..|:||....|  :.:.|||........|.....|.|.|.|.....|..|
Mouse    17 TILRTMGPKDKAAVSCRPSTSECNMG--NKTGAAAPVMEPILRGRANHPGRGHSCGTRTQVRDHG 79

  Fly   295 TSVIT--------SADHHMTTVPTPAQSL-EGSCDSSSPSPSSTSG--AAILPISVSVNRKNGA- 347
            .:::.        ||......:..|..:| ....|.:..:|:...|  |...|:|...:....: 
Mouse    80 EALLAVGSEQKGYSARGKRRQIRLPRTTLPRKPFDQAKKTPTKGRGRPAKENPVSQPEDLPQASP 144

  Fly   348 --NVPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEARVEIN 403
              ..|.|..|   ||        :|..|.||.|:.:......:...|..|..|..|.|
Mouse   145 QEESPHGSQV---YC--------WPPALSPLPYMSVPPEQQLVAPPSTEIHGAFAESN 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137
DSX_dimer 353..404 CDD:285978 13/51 (25%)
Dmrtc1c1XP_006528348.1 PHA03247 <93..227 CDD:223021 25/110 (23%)
DMRT-like 179..>247 CDD:374115 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.