DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrtc1a

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_006528343.1 Gene:Dmrtc1a / 70887 MGIID:1918137 Length:227 Species:Mus musculus


Alignment Length:194 Identity:49/194 - (25%)
Similarity:74/194 - (38%) Gaps:59/194 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 EEAS---RRIEEARVEINRTVAQIYYNYYTPMALVNGAPMYLTYPSIEQG-RYGAHFTHLPLTQI 449
            |||:   ||:.|..   .||           ||..:.:.|::...::|:| |.|.:.......|:
Mouse    23 EEATPLKRRLVERH---KRT-----------MAAAHPSHMHVKKLAVEEGVRTGKNTVQQIQAQV 73

  Fly   450 CPPTPE-----PLALSRSP---SSPSGPSAVHNQ-KPSRPGSSNGTVHSAASPTMVTTM-----A 500
            ...|.|     |:.|::.|   |.|..|..|..| ..|.||..:||   :|.|:|..::     |
Mouse    74 DTATQEESSQGPVLLNQHPETTSVPYTPETVGQQLMVSLPGEPHGT---SAMPSMCPSLILQPCA 135

  Fly   501 TTSSTPTLSRRQRSRSATPTTPPPPPPAHSSSNGAYHHGHHLVSSTAATXQYRNVAAAVAAAAA 564
            ||.               |....|.....|:||.|         |.:||.:::.:..|..|..|
Mouse   136 TTD---------------PMLLQPQVMGPSASNQA---------SVSATLEWQEMLEAAEALLA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137
DSX_dimer 353..404 CDD:285978 6/17 (35%)
Dmrtc1aXP_006528343.1 DMRT-like 112..226 CDD:374115 22/91 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.