DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrt1

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_030106845.1 Gene:Dmrt1 / 50796 MGIID:1354733 Length:475 Species:Mus musculus


Alignment Length:239 Identity:78/239 - (32%)
Similarity:107/239 - (44%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGASSS------SGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMA 84
            ||||.|      |||..|||. |.||||||||....||||||:|.:|.|.|:||.|.|:||||||
Mouse    51 GGASGSGPSGLGSGSKKSPRL-PKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMA 114

  Fly    85 LQTALRRAQAQDEQRALHMHEVP-PANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHG 148
            .|.||||.|||:|:..: .|.:| |:  ||..|:...::.:.|..:..:...|            
Mouse   115 AQVALRRQQAQEEELGI-SHPIPLPS--AAELLVKRENNASNPCLMAENSSSA------------ 164

  Fly   149 HVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHH 213
                  |...|:...|:|....:......|.:..|     |:...:...:..|.:.....| |..
Mouse   165 ------QPPPASTPTPAASEGRMVIQDIPAVTSRG-----HMENTSDLVSDPAYYSSFYQP-SLF 217

  Fly   214 HHHQNHHQHPHQQPATQTALRSPPHSDHGGSVGPATSSSGGGAP 257
            .::.|.:.:|....|......|       |.||    :|.||:|
Mouse   218 PYYNNLYNYPQYSMALSAESSS-------GEVG----NSLGGSP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 29/44 (66%)
DSX_dimer 353..404 CDD:285978
Dmrt1XP_030106845.1 DM 70..116 CDD:366283 30/46 (65%)
Dmrt1 128..200 CDD:372081 15/97 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6174
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4813
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.