DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrtc2

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_008765121.1 Gene:Dmrtc2 / 499100 RGDID:1583739 Length:397 Species:Rattus norvegicus


Alignment Length:103 Identity:44/103 - (42%)
Similarity:53/103 - (51%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGGASSSS-------GSSISPRTP----PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTAD 78
            |...||.:       .:.:.||.|    |.||||||||:...||||||.|.|:.|.|.||.|..:
  Rat    39 CSADSSPADEARVPQSTELIPRRPVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILE 103

  Fly    79 RQRVMALQTALRRAQAQDEQRALHMHEVPPANPAATTL 116
            |:||||.|.||||.|....:|.|....:..|.|....|
  Rat   104 RRRVMAAQVALRRQQEAQLKRHLAQGLMKGAAPLKAPL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 28/48 (58%)
DSX_dimer 353..404 CDD:285978
Dmrtc2XP_008765121.1 DM 65..111 CDD:279137 27/45 (60%)
DMRT-like 270..395 CDD:292419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.