DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrta1

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001101415.1 Gene:Dmrta1 / 313352 RGDID:1309796 Length:488 Species:Rattus norvegicus


Alignment Length:280 Identity:88/280 - (31%)
Similarity:110/280 - (39%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALH 102
            ||| |.||||||||:...||||||:|::|.|.|.||.|.|:||||||.|.||||.|||:|..|..
  Rat    79 PRT-PKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARG 142

  Fly   103 MHEV---PPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAP 164
            :|.:   .|:.|            .|||           :.|...:....||......||..|..
  Rat   143 LHRLLYQGPSGP------------GAPA-----------SGGSGRTESPQVLSSPMTVAALGAGA 184

  Fly   165 SAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPAT 229
            |   .|.|..|..|..:.....|..           .|...||:..|        .|..|::|.:
  Rat   185 S---RHPGSRSVPAFEVFQQDFAER-----------KQEPKQSNCES--------CQSRHEEPVS 227

  Fly   230 QTALRSPPHSDHGGSVGPATSSSGGGAPSSSNAAAATS------SNGSSGGGGGGGGGSSGGGAG 288
            .|..|||     |.|.|..|....|...|.|..:..::      ....|||.......||.....
  Rat   228 NTHHRSP-----GSSNGNVTMEKQGFMSSISEQSDKSTIILSPCPTDQSGGEDSPRSFSSSDLES 287

  Fly   289 GGRSSGTSVITSADHHMTTV 308
            |..|......|:....::||
  Rat   288 GNESEWARDYTATTASLSTV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 29/44 (66%)
DSX_dimer 353..404 CDD:285978
Dmrta1NP_001101415.1 DM 80..126 CDD:279137 31/46 (67%)
DMA 313..348 CDD:281472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.