powered by:
Protein Alignment dsx and Dmrt2
DIOPT Version :9
Sequence 1: | NP_001262353.1 |
Gene: | dsx / 40940 |
FlyBaseID: | FBgn0000504 |
Length: | 572 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101067.1 |
Gene: | Dmrt2 / 309430 |
RGDID: | 1309047 |
Length: | 560 |
Species: | Rattus norvegicus |
Alignment Length: | 74 |
Identity: | 38/74 - (51%) |
Similarity: | 49/74 - (66%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 SSGSSISPR---TPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRA 92
::|....|| ..|.||||||||:...||||||:|::|.|.|..|.|..:||||||.|.||||.
Rat 105 TAGGGAEPRKLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQ 169
Fly 93 QAQDEQRAL 101
||.::::.|
Rat 170 QATEDKKGL 178
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dsx | NP_001262353.1 |
DM |
41..86 |
CDD:279137 |
27/44 (61%) |
DSX_dimer |
353..404 |
CDD:285978 |
|
Dmrt2 | NP_001101067.1 |
DM |
117..163 |
CDD:395608 |
27/45 (60%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3815 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D383821at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.