DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrta1

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_783578.1 Gene:Dmrta1 / 242523 MGIID:2653627 Length:490 Species:Mus musculus


Alignment Length:238 Identity:76/238 - (31%)
Similarity:99/238 - (41%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALH 102
            ||| |.||||||||:...||||||:|::|.|.|.||.|.|:||||||.|.||||.|||:|..|..
Mouse    81 PRT-PKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARG 144

  Fly   103 MHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAPSAP 167
            :|.:.....:.:                    .|..:.|...:....||::..|.|...|..|  
Mouse   145 LHRLLYQGSSGS--------------------GAQASGGSGRTESPQVLNNPMAVAVLGAGAS-- 187

  Fly   168 ASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTA 232
             .|.|..|.....:....:|..............| ..|..|.|:.|||.......:.....|..
Mouse   188 -RHPGSRSVPTFEVFQQDYADRKQEPKQRNCESCQ-SRQEEPVSNTHHHSLGSSKGNVTVEKQGF 250

  Fly   233 LRS-PPHSDHGG---SVGPATSSSGGGAPSSSNAAAATSSNGS 271
            :.| |.|.|...   |..|...|.|..:|.|.:::...|.|.|
Mouse   251 MSSIPEHPDKSTIILSPCPTDQSGGEDSPRSFSSSDLESGNES 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 29/44 (66%)
DSX_dimer 353..404 CDD:285978
Dmrta1NP_783578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
DM 82..128 CDD:279137 31/46 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..171 2/38 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..289 18/82 (22%)
DMA 315..350 CDD:281472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.