DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrt2

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_665830.1 Gene:Dmrt2 / 226049 MGIID:1330307 Length:561 Species:Mus musculus


Alignment Length:118 Identity:44/118 - (37%)
Similarity:66/118 - (55%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GASSSSGSSISPR---TPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTA 88
            ||::..|:  .||   ..|.||||||||:...||||||:|::|.|.|..|.|..:||||||.|.|
Mouse   105 GATAGGGA--EPRKLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVA 167

  Fly    89 LRRAQAQD------------EQRALHMHEVPPANPAATTLLSHHHHVAAPAHV 129
            |||.||.:            :::|::..:|...:..|.::|..:..:.|..::
Mouse   168 LRRQQATEDKKGLSGKQNNFDRKAVYQRQVRAPSLLAKSILEGYRPMTAETYL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 27/44 (61%)
DSX_dimer 353..404 CDD:285978
Dmrt2NP_665830.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 5/15 (33%)
DM 119..165 CDD:279137 27/45 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.