powered by:
Protein Alignment dsx and dmd-9
DIOPT Version :9
Sequence 1: | NP_001262353.1 |
Gene: | dsx / 40940 |
FlyBaseID: | FBgn0000504 |
Length: | 572 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500305.1 |
Gene: | dmd-9 / 190512 |
WormBaseID: | WBGene00022060 |
Length: | 254 |
Species: | Caenorhabditis elegans |
Alignment Length: | 87 |
Identity: | 24/87 - (27%) |
Similarity: | 32/87 - (36%) |
Gaps: | 20/87 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 CARCRNHGLKITLKGHKRYCKFRYCTCEKC------------RLTADRQ--RVMALQTALRRAQA 94
|.:|..||....||||...|.::.|:|..| |....|| :.||:..|||....
Worm 31 CRKCEGHGTYAILKGHAGVCPYKDCSCGTCASVMSMRANALIRRFRHRQPDQSMAVVKALRSKNG 95
Fly 95 QDEQRALHMHEVPPANPAATTL 116
....| :.|.|...|.:
Worm 96 NMRLR------IVPRNDEETVV 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dsx | NP_001262353.1 |
DM |
41..86 |
CDD:279137 |
17/55 (31%) |
DSX_dimer |
353..404 |
CDD:285978 |
|
dmd-9 | NP_500305.1 |
DM |
27..79 |
CDD:214606 |
13/47 (28%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3815 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12322 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.