DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and dmd-3

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001256882.1 Gene:dmd-3 / 189878 WormBaseID:WBGene00012832 Length:250 Species:Caenorhabditis elegans


Alignment Length:119 Identity:41/119 - (34%)
Similarity:58/119 - (48%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TMSDSDMID--SKNDVCGGASSSSGSSISPRTP----PNCARCRNHGLKITLKGHKRYCKFRYCT 69
            |.|:.|.::  |:::.   .:.|||.......|    |||.||..|.:...||||||.|.||.|.
 Worm    81 TCSEEDQMECTSQSET---TNESSGEDKDDGKPKERRPNCQRCAQHSVVNRLKGHKRACPFRDCF 142

  Fly    70 CEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEVP--------PANPAATT 115
            |.||::..:||::||.|..|||.|.:::.......|.|        |.:...||
 Worm   143 CAKCQVVVERQKLMADQIKLRRRQKREKNNLNSEREAPIAHSMTPSPIDTVTTT 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 24/48 (50%)
DSX_dimer 353..404 CDD:285978
dmd-3NP_001256882.1 DM 15..60 CDD:366283
DM 113..166 CDD:214606 27/52 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.