DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and dmd-4

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_510466.1 Gene:dmd-4 / 181581 WormBaseID:WBGene00007776 Length:260 Species:Caenorhabditis elegans


Alignment Length:81 Identity:43/81 - (53%)
Similarity:51/81 - (62%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEV 106
            |.|||||||||...||||||:||::.|.||||.|.|:||||||.|.||:|.||.::..||.:..|
 Worm    20 PKCARCRNHGLVSWLKGHKRHCKYKECACEKCNLIAERQRVMAAQVALKRRQATEDAIALGLRVV 84

  Fly   107 P-------PANPAATT 115
            .       |..|...|
 Worm    85 AGQAIDRLPQGPVWNT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 31/43 (72%)
DSX_dimer 353..404 CDD:285978
dmd-4NP_510466.1 DM 18..64 CDD:366283 31/43 (72%)
CUE_DMA 142..181 CDD:270553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006418
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.