DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and AgaP_AGAP001388

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_321748.3 Gene:AgaP_AGAP001388 / 1281789 VectorBaseID:AGAP001388 Length:286 Species:Anopheles gambiae


Alignment Length:62 Identity:32/62 - (51%)
Similarity:42/62 - (67%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHM 103
            |.||||||||:...|:|||:.|.:|.|.|.||.|...||::||.|.||:|.||.::..||.:
Mosquito    11 PKCARCRNHGVISGLRGHKKLCSYRNCRCAKCELILSRQKIMAAQVALKRQQAVEDAIALRL 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 24/43 (56%)
DSX_dimer 353..404 CDD:285978
AgaP_AGAP001388XP_321748.3 DM 9..55 CDD:279137 24/43 (56%)
DMA 146..180 CDD:281472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.