DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrt1

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_446158.1 Gene:Dmrt1 / 114498 RGDID:621640 Length:374 Species:Rattus norvegicus


Alignment Length:363 Identity:98/363 - (26%)
Similarity:137/363 - (37%) Gaps:112/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GGASSS------SGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMA 84
            ||||.|      |||..|||. |.||||||||....||||||:|.:|.|.|:||.|.|:||||||
  Rat    51 GGASGSGPSGLGSGSKKSPRL-PKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMA 114

  Fly    85 LQTALRRAQAQDEQRALHMHEVP-PANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHG 148
            .|.||||.|||:|:..: .|.:| |:  ||..|:...:..:.|.                     
  Rat   115 AQVALRRQQAQEEELGI-SHPIPLPS--AAELLVKRENSASNPC--------------------- 155

  Fly   149 HVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHH 213
              |..:.:::|.....|.|...:.........|.......|:..|....:..|.:.....| |..
  Rat   156 --LMAESSSSAQPPPASTPTPTVSEGRMVIQDIPAVTSRGHMENAPDLMSDPAYYSSFYQP-SLF 217

  Fly   214 HHHQNHHQHPHQQPA------------------TQTALRSPP----------------------- 237
            .::.|.:.:|....|                  .:.:|||.|                       
  Rat   218 PYYNNLYNYPQYSMALSAESSSGDVGNPLGGSPVKNSLRSLPAPYVPAQTGNQWQMKTSEGRHPV 282

  Fly   238 ------HSDHG--GSVGPATSS--SGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRS 292
                  ||.:|  ..:|.:.|.  :....||.|.|.|:..|..||                  :.
  Rat   283 SSQYRMHSYYGPPSYLGQSMSQIFTFEEGPSYSEAKASVFSPPSS------------------QD 329

  Fly   293 SGTSVITSADHHMTTVPTPAQSLEG--SCDSSSPSPSS 328
            ||...::|:.      |...:|.:|  .|:|:|..|||
  Rat   330 SGLVSLSSSS------PMSNESTKGVLECESASSEPSS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 29/44 (66%)
DSX_dimer 353..404 CDD:285978
Dmrt1NP_446158.1 DM 70..116 CDD:279137 30/46 (65%)
Dmrt1 128..200 CDD:289167 14/97 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12322
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4813
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.