DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and Dmrtc1a

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_038955317.1 Gene:Dmrtc1a / 108348153 RGDID:11451771 Length:289 Species:Rattus norvegicus


Alignment Length:204 Identity:41/204 - (20%)
Similarity:73/204 - (35%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 ASRRIEEARVEINRTVAQIYYNYYTPMALVNGAPMYLTYPSIEQG-RYGAHFTH----------- 443
            ||::.:..||:     ..:.......||....:.:::...::|:| |.|.:..|           
  Rat    83 ASKKEQATRVK-----KHVVRRQKGTMAAAPKSHVHVKKLTVEEGVRTGKNSVHQLQAQVDTATQ 142

  Fly   444 ------------LPLTQICPPTPEPLALSRSPS---SPSGPSAVHNQKPS--------------R 479
                        ||.|...|.|||.:....:.|   .|.||||:.:..||              :
  Rat   143 QESSQGPVLLSQLPETTSVPYTPETMGQQLTVSLSGEPYGPSAMPSMCPSLILQPCATTDPMLLQ 207

  Fly   480 PGSSNGTVHSAASPTMVTTMATTSSTPTLSRRQRSRS-----ATPTT--------PPPPPPAHSS 531
            |..|:.:..::.|.|:.......::...|:.:..|::     ..|.|        |.|..|...:
  Rat   208 PQGSSASNQASVSATLEWQEMLEAAEALLALKNSSQTRHQPCGMPGTAGERGLQLPNPSMPPRPA 272

  Fly   532 SNGAYHHGH 540
            |:|:...||
  Rat   273 SSGSLPSGH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137
DSX_dimer 353..404 CDD:285978 4/12 (33%)
Dmrtc1aXP_038955317.1 DMRT-like 176..288 CDD:374115 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.