DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and dmrtb1

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_002931473.2 Gene:dmrtb1 / 100497719 XenbaseID:XB-GENE-6458749 Length:249 Species:Xenopus tropicalis


Alignment Length:232 Identity:50/232 - (21%)
Similarity:79/232 - (34%) Gaps:85/232 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASSSSGSSISPRT--PPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALR 90
            ||:...|.:.|:.  .|.|:|||||||.:.::||...|..::|||.||.|.::|.:::|....||
 Frog     4 ASAEPASLVPPKVARTPKCSRCRNHGLLVPVRGHSGRCARKFCTCPKCSLISERAKILAAHKQLR 68

  Fly    91 RAQAQDEQRALHMHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQ 155
            ::..|.|.                         |||             .||.            
 Frog    69 KSAPQAES-------------------------AAP-------------EGGE------------ 83

  Fly   156 AAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVA--QHQHQSHPHSHHHHHQN 218
                            ||:|.||:....|   ..:..|....:.:.  .|..:..|:..:...:.
 Frog    84 ----------------GGNSKAATGAGSH---KEIGQAVVKYSDIGPPPHHLECMPNMEYFERET 129

  Fly   219 HHQHPHQQPATQTALRSPPHS--------DHGGSVGP 247
            ...:|...|    ....||.|        .:||::.|
 Frog   130 SRIYPAYPP----MCTYPPFSMGLKVAPPGYGGAIPP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 20/44 (45%)
DSX_dimer 353..404 CDD:285978
dmrtb1XP_002931473.2 DM 18..63 CDD:395608 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.