DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsx and dmrt2

DIOPT Version :9

Sequence 1:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001093726.1 Gene:dmrt2 / 100101749 XenbaseID:XB-GENE-876152 Length:528 Species:Xenopus tropicalis


Alignment Length:141 Identity:46/141 - (32%)
Similarity:69/141 - (48%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MSDSDMIDSKNDVCGGASSSSGSSIS-----------PRTPPNCARCRNHGLKITLKGHKRYCKF 65
            :.:.|..:.:.:...||..|.|....           .|| |.||||||||:...||||||:|::
 Frog    55 LDEEDEDEEEQEGADGAPVSKGEQQKANEKGGEQRKLSRT-PKCARCRNHGVVSCLKGHKRFCRW 118

  Fly    66 RYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRAL------------HMHEVPPANPAATTLLS 118
            |.|.|..|.|..:||||||.|.||||.||.::::.|            :...:.|.:..|.::|.
 Frog   119 RDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSAKPSIAERKPVYQRHIRPPSLLAKSILE 183

  Fly   119 HHHHVAAPAHV 129
            .:..|...:::
 Frog   184 GYRPVQTDSYL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsxNP_001262353.1 DM 41..86 CDD:279137 27/44 (61%)
DSX_dimer 353..404 CDD:285978
dmrt2NP_001093726.1 DM 93..139 CDD:307066 29/46 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.