DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and ZSCAN20

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001364305.1 Gene:ZSCAN20 / 7579 HGNCID:13093 Length:1043 Species:Homo sapiens


Alignment Length:415 Identity:102/415 - (24%)
Similarity:150/415 - (36%) Gaps:74/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ERPVKRGDLLPQFICVSCVLAVQNAFRFKWQSEQ--SYQHFFRVLNQSGAPENQVHLAACNGDKN 109
            |..||...|.|:        |....|..:.:.|.  |.|..|..|  .||      |:.|   ..
Human   609 EDAVKPSTLCPK--------APDMGFEMRHEDEDQISEQDIFEGL--PGA------LSKC---PT 654

  Fly   110 QIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEE 174
            :.:.|.:....|.:.:.:...:...|    ||:|     .||.:.:...|....|..........
Human   655 EAVCQPLDWGEDSENENEDEGQWGNP----SQEQ-----WQESSSEEDLEKLIDHQGLYLAEKPY 710

  Fly   175 QADMIPKEATRSTKMIC-----DADGYYNCPHCSKRFCSQTQLRTHITDLCNRCPY----CPRTY 230
            :.|...|..:||:..|.     ..:..|.|..|.|.|..::.|.||........||    |.:::
Human   711 KCDTCMKSFSRSSHFIAHQRIHTGEKPYKCLECGKNFSDRSNLNTHQRIHTGEKPYKCLECGKSF 775

  Fly   231 MQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIH 295
            ...|||..|.|.|..:..:||..|.|:|.:..:|.:|.|.|....|..||:....|.:......|
Human   776 SDHSNLITHQRIHTGEKPYKCGECWKSFNQSSNLLKHQRIHLGGNPDQCSEPGGNFAQSPSFSAH 840

  Fly   296 RREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNG----TCS----------------- 339
            .|      .|::..:.:.|.|    .::||......:|.:|    .||                 
Human   841 WR------NSTEETAPEQPQS----ISKDLNSPGPHSTNSGEKLYECSECGRSFSKSSALISHQR 895

  Fly   340 IPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL- 403
            |....||.. |..|.|.||....|..|..||..:... ||..|.:.|.....|..|:|.|.|:. 
Human   896 IHTGEKPYE-CAECGKSFSKSSTLANHQRTHTGEKPY-KCVDCGKCFSERSKLITHQRVHTGEKP 958

  Fly   404 FRCEFCSLVFVDVNYLRKHKKRIHS 428
            ::|..|...|.|.:.|..| :|||:
Human   959 YKCLECGKFFRDRSNLITH-QRIHT 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 10/39 (26%)
COG5048 220..>284 CDD:227381 21/67 (31%)
C2H2 Zn finger 223..243 CDD:275368 8/23 (35%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 7/20 (35%)
ZSCAN20NP_001364305.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SCAN 47..132 CDD:396558
Myb_DNA-bind_4 323..404 CDD:404682
Myb_DNA-bind_4 483..564 CDD:404682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 661..692 7/39 (18%)
COG5048 699..>1029 CDD:227381 77/297 (26%)
C2H2 Zn finger 712..732 CDD:275368 5/19 (26%)
C2H2 Zn finger 740..760 CDD:275368 7/19 (37%)
C2H2 Zn finger 768..788 CDD:275368 6/19 (32%)
C2H2 Zn finger 796..816 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 835..873 9/47 (19%)
C2H2 Zn finger 877..897 CDD:275368 2/19 (11%)
C2H2 Zn finger 905..925 CDD:275368 7/19 (37%)
C2H2 Zn finger 933..953 CDD:275368 6/19 (32%)
C2H2 Zn finger 961..981 CDD:275368 7/20 (35%)
C2H2 Zn finger 989..1009 CDD:275368
C2H2 Zn finger 1017..1037 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.