DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and ZNF574

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001317448.1 Gene:ZNF574 / 64763 HGNCID:26166 Length:986 Species:Homo sapiens


Alignment Length:395 Identity:89/395 - (22%)
Similarity:144/395 - (36%) Gaps:74/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QSEQSYQHFFRVLNQSGAPENQVHLAACNGD----------KNQIINQKMQLKSD---------- 121
            |:..:.:|.:|...:.|........||...:          |....:|..||.:|          
Human   264 QARVAVEHSYRKAEEGGEGATVPSAAATTTEVVTEVELLLYKCSECSQLFQLPADFLEHQATHFP 328

  Fly   122 ----------RQQDTQQMTKTQKPDDDLSQKQTLQA-----KLQEGNIDGPPESFTLHPRKRTCR 171
                      .||:.|..:..:.|   :||...|.|     :|:.|...|         |.|..|
Human   329 APVPESQEPALQQEVQASSPAEVP---VSQPDPLPASDHSYELRNGEAIG---------RDRRGR 381

  Fly   172 TEEQADMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQLRTHI---TDLCNRCPYCPRTYMQK 233
            ...:.:........:.::.|.|        |.:.|.|..||:.|:   .:...:||.|.|.:...
Human   382 RARRNNSGEAGGAATQELFCSA--------CDQLFLSPHQLQQHLRSHREGVFKCPLCSRVFPSP 438

  Fly   234 SNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRRE 298
            |:|.:||.:|.|:....|..|..||..:..|..|.|.| :..||....|...|:...:...|||.
Human   439 SSLDQHLGDHSSESHFLCVDCGLAFGTEALLLAHRRAH-TPNPLHSCPCGKTFVNLTKFLYHRRT 502

  Fly   299 H---------KQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQ 354
            |         ...|.........:|...::.:.:..:|..::.|..|..: |...:    |.:|.
Human   503 HGVGGVPLPTTPVPPEEPVIGFPEPAPAETGEPEAPEPPVSEETSAGPAA-PGTYR----CLLCS 562

  Fly   355 KKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL-FRCEFCSLVFVDVNY 418
            ::|.....|.||....:|.....||:.|.:.||.:.|::.|.|.|.|:. |.|..||..|.....
Human   563 REFGKALQLTRHQRFVHRLERRHKCSICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPAN 627

  Fly   419 LRKHK 423
            |.:|:
Human   628 LARHR 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 1/7 (14%)
COG5048 220..>284 CDD:227381 21/63 (33%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 6/18 (33%)
ZNF574NP_001317448.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.