DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and AgaP_AGAP004830

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_001688568.1 Gene:AgaP_AGAP004830 / 4576427 VectorBaseID:AGAP004830 Length:508 Species:Anopheles gambiae


Alignment Length:395 Identity:88/395 - (22%)
Similarity:136/395 - (34%) Gaps:93/395 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKNVCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQ 69
            |.::||.||. |..|.|||.      .|.|......|:..||...:...|.||..||..|:..|:
Mosquito   162 ALDMCRVCMG-TEELSDIFQ------FDGPVRVSDIIMKVCTNIRITARDHLPHKICEQCLGQVR 219

  Fly    70 NAFRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQ----IINQKMQLKSDRQQDTQQMT 130
            ....||.:.|.|.:...:.|.:|           .|..:.|    ::|..|   ||..:|.::..
Mosquito   220 IVNEFKNRCEASDKELRKNLKRS-----------TNKSRRQSEVIVVNCPM---SDSDKDDEEPV 270

  Fly   131 KTQKPDDD---LSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRT--EEQADMIPKEATRSTKMI 190
                 |||   :||.:.........:...||......|::|..|.  ..:....||....||...
Mosquito   271 -----DDDEYKVSQSEVESEPATSDDSFSPPNKRKRTPKRRVGRPPGRGRPGRKPKNMVVSTPKF 330

  Fly   191 CDADG-----------------YYNCPHCSKRFCSQTQL---RTHITDLCNRCPYCPRTYMQKSN 235
            ....|                 |...|..|.....:.::   |....|  |.||.|......:..
Mosquito   331 AVKRGPGRPPKYPKTSSLTNIVYIEAPEDSSSSGEEAEVTPKRRKRGD--NPCPKCDEVLPSQLA 393

  Fly   236 LKRHLRNHLSKPAHK--CFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRRE 298
            ||:||:.|   |..:  |..|:..|..:..|..|:..|.....:.              |..|:|
Mosquito   394 LKQHLKTH---PGDRFDCDRCALFFRTEKALSNHIERHKKADKIR--------------EEKRKE 441

  Fly   299 HKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPIC-----DI--CQKK 356
            .:||   .:..|...|.|.|:::::.:.|:       |:.:.....|.:|..     |:  |...
Mosquito   442 REQR---IEQRSRYTPKSSDAEKSKLISPQ-------GSATAEKKKKSEPSAASSGRDLFKCVAP 496

  Fly   357 FSSVY 361
            .:|.|
Mosquito   497 LTSTY 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 25/76 (33%)
COG5048 220..>284 CDD:227381 16/65 (25%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-C2H2 249..271 CDD:278523 5/23 (22%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
C2H2 Zn finger 350..370 CDD:275368 4/19 (21%)
C2H2 Zn finger 379..399 CDD:275368
C2H2 Zn finger 406..427 CDD:275368
AgaP_AGAP004830XP_001688568.1 zf-AD 165..237 CDD:214871 25/78 (32%)
C2H2 Zn finger 381..401 CDD:275371 7/19 (37%)
C2H2 Zn finger 408..429 CDD:275371 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.