DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG10669

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001163728.1 Gene:CG10669 / 43069 FlyBaseID:FBgn0039329 Length:933 Species:Drosophila melanogaster


Alignment Length:494 Identity:102/494 - (20%)
Similarity:158/494 - (31%) Gaps:160/494 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKNVCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQ 69
            |.:||:.|...       |.|::         .|.|..::..:..:||      |:|..|     
  Fly   516 APHVCQRCDSR-------FLNLQ---------LLKHHTSQLCQNTLKR------FMCDKC----- 553

  Fly    70 NAFRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACN---GDKNQIINQKMQLKSDRQQD---TQQ 128
             ..||.|:.............|...|.:|     |:   .||:.:...|:.:..|...:   .:.
  Fly   554 -PQRFFWRRNLRAHLVEHKCKQESYPCDQ-----CSRSFQDKSAVTKHKLMMHRDSNMELLPCRW 612

  Fly   129 MTKT-QKP-------------DDDLSQKQTLQAKLQEGNIDGPPES----------FTLHPRKRT 169
            .|:| .:|             ..||...:||   |.:.:....|:|          .::...:|.
  Fly   613 CTRTFYRPALLYKHLQRHGFTGQDLPLAETL---LADASKPAGPKSVQCKICDIQFVSVADLRRH 674

  Fly   170 CRTEEQADMIPKEATRSTKMICDADGY------------------YNCPHCS-----KRFCSQTQ 211
            ...:..:|.      .|..||..|.|:                  |:|..|.     :|..|:.|
  Fly   675 ISMQGHSDQ------PSAYMISTATGFELLLDDTDDSDEETSGRTYSCDLCDLNFRRRREISEHQ 733

  Fly   212 LRTHITD-LCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHK--CFHCSKAFMRKDHLKRHLRTHDS 273
            ...|..| |.:.|.:|....:.|:.|.:|||........|  |..|...||.:::|.:||.|..|
  Fly   734 YSLHSFDKLPHNCEHCIFKTVDKNMLHQHLRTQCMNTEKKFACMRCGYKFMWEENLAQHLSTQHS 798

  Fly   274 DGP----------------LSCSQCSAVFIEHVQLEIHRRE-H--KQRPGSSKSESTKDPDSDDS 319
            ..|                ..|..|...|:....|:.|.|: |  |:.||.              
  Fly   799 KQPAVPEQQPPLRRKRRFRYQCPHCWRSFVVQPSLDKHIRDMHVAKKNPGK-------------- 849

  Fly   320 DQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSE 384
                                       |.:|.:|..:..:...|..||..|..:... ||..|..
  Fly   850 ---------------------------KYLCSLCGLESLTPNKLNIHMRRHTGEKPF-KCDLCDM 886

  Fly   385 EFKTEKHLKRHERGHMGDL-FRCEFCSLVFVDVNYLRKH 422
            .|.....||.|.|.|.|:. ::|.||...|...:.||:|
  Fly   887 RFTVHYELKVHRRKHTGERPYQCTFCDKDFARPDKLRRH 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 15/76 (20%)
COG5048 220..>284 CDD:227381 20/81 (25%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-C2H2 249..271 CDD:278523 8/23 (35%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 6/20 (30%)
C2H2 Zn finger 350..370 CDD:275368 5/19 (26%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 7/17 (41%)
CG10669NP_001163728.1 zf-AD 4..81 CDD:285071
C2H2 Zn finger 178..199 CDD:275368
C2H2 Zn finger 216..233 CDD:275368
C2H2 Zn finger 520..542 CDD:275368 6/37 (16%)
C2H2 Zn finger 550..570 CDD:275368 5/25 (20%)
C2H2 Zn finger 579..600 CDD:275368 5/25 (20%)
C2H2 Zn finger 610..630 CDD:275368 3/19 (16%)
C2H2 Zn finger 716..737 CDD:275368 5/20 (25%)
C2H2 Zn finger 746..766 CDD:275368 7/19 (37%)
C2H2 Zn finger 776..795 CDD:275368 7/18 (39%)
C2H2 Zn finger 820..838 CDD:275368 5/17 (29%)
C2H2 Zn finger 853..873 CDD:275368 5/19 (26%)
zf-H2C2_2 866..889 CDD:290200 7/23 (30%)
COG5048 877..>930 CDD:227381 17/50 (34%)
C2H2 Zn finger 881..901 CDD:275368 7/19 (37%)
zf-H2C2_2 893..918 CDD:290200 10/24 (42%)
C2H2 Zn finger 909..929 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.