DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and Odj

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:451 Identity:89/451 - (19%)
Similarity:158/451 - (35%) Gaps:136/451 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAFR 73
            ||.|.:.      ||......:.::....:...:.:.|...:...::|||.||..|:|.:..|..
  Fly     5 CRICGER------IFTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVA 63

  Fly    74 FKWQSEQSYQHFF-RVLNQSG-APENQVHLAACNGD---KNQIINQKMQLKSDRQ--QDTQQMTK 131
            |:.:..:::.:.. |:.:::| |.:....::....|   |.::::..:..:.|::  .|.:.:. 
  Fly    64 FRQRCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDDDKDLM- 127

  Fly   132 TQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGY 196
                |||   |..|:        |..|  ...:|..:..|.|:|                     
  Fly   128 ----DDD---KDFLE--------DEKP--ILRYPPAKKIRIEDQ--------------------- 154

  Fly   197 YNCPHCSKRFCSQTQLRTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKP-------AHKCFHC 254
             |.|:.........:||..:.:..:..|..||.:::|...:|      .||       .:.|..|
  Fly   155 -NFPNRQSPRVRVKRLRVPVVEKADSPPPPPREHVRKPRKRR------PKPKVDRSIKRYVCDQC 212

  Fly   255 SKAF----MRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPD 315
            ..:|    ..|||..||.     :...||.:|...|.....|.:|.|.|      .|.|      
  Fly   213 GWSFNDHSNMKDHKLRHF-----EEKFSCDECGRKFYTMPLLRLHIRVH------HKGE------ 260

  Fly   316 SDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKP-ICDICQKKFSSVYALKRHMLTHNRQHHLKK- 378
                                           || :|..|...|::..:..|    |.||.|..: 
  Fly   261 -------------------------------KPYVCKFCGMGFANSPSRCR----HERQMHANEL 290

  Fly   379 ---CTYCSEEFKTEKHLKRHERGHMG---DLFRCEFCSLVFVDVNYLRK------HKKRIH 427
               |..|.:.|.:||...:||.||..   |:..|..|:..|.:..:|.:      |:||::
  Fly   291 VHPCKICGKRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTKYHRKRVN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 15/75 (20%)
COG5048 220..>284 CDD:227381 18/74 (24%)
C2H2 Zn finger 223..243 CDD:275368 5/19 (26%)
zf-C2H2 249..271 CDD:278523 8/25 (32%)
C2H2 Zn finger 251..271 CDD:275368 8/23 (35%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 4/19 (21%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 7/26 (27%)
OdjNP_650661.1 zf-AD 5..77 CDD:214871 15/77 (19%)
COG5048 <202..343 CDD:227381 42/192 (22%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 249..274 CDD:290200 11/67 (16%)
C2H2 Zn finger 265..283 CDD:275368 5/21 (24%)
C2H2 Zn finger 298..314 CDD:275368 5/15 (33%)
zf-C2H2_jaz 322..347 CDD:288983 4/24 (17%)
C2H2 Zn finger 324..343 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.