DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG17806

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:471 Identity:105/471 - (22%)
Similarity:166/471 - (35%) Gaps:126/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCRTCMDETGTLVDIF-ANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNA 71
            :||||..|......:| ...||        .||:|| :.|...::....:|..||:||:|.:.:|
  Fly     4 LCRTCGQEAEHAKSLFDKEARD--------VLSNIL-KLTGFWLRNQPGVPTRICLSCLLDLNDA 59

  Fly    72 FRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIIN------------QKMQLKSDRQQ 124
            ..|:.:..::...:|   .:.|..|:.....|..|..|::.:            |:.::...|.:
  Fly    60 IAFRERCIRTNSSWF---EKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSK 121

  Fly   125 --DTQQMTKTQKP--------------DDDLSQKQTLQAKLQ-EGNIDGPPESFTLHPRKRTCRT 172
              |...:...:.|              .|.|..:..:|.|.: :.:.|.|.||.. |        
  Fly   122 KVDGVPLKTVETPIYPLVVPEIPPADLVDPLRCEDPIQVKSEPQLSSDYPVESMN-H-------- 177

  Fly   173 EEQADMIP---KEATRSTKMICDADGYYNCP-------HCSKRFCSQTQLRTHITDLCNRCPYCP 227
            ||.|..:|   ||..|:.::|.:.......|       .|..:..::.:.....|:......|..
  Fly   178 EEPASEMPQVMKEEPRTLQVIGEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYAT 242

  Fly   228 RTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAV-FIEHVQ 291
            |.....:.....|.:.|    :.|..|.|.|..|.:...|||.|.......|.:|..: |.:|: 
  Fly   243 RNKWGAAKRAYALEHRL----YFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHL- 302

  Fly   292 LEIH-RREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQK 355
            |.:| |.:|:.                                     .:|      .:|..|.|
  Fly   303 LNLHVRIKHRG-------------------------------------ELP------YVCKYCGK 324

  Fly   356 KFSSVYALKRHMLTHNRQH--------HLKKCTYCSEEFKTEKHLKRHERGHMGDL-FRCEFCSL 411
            :|.:  .|||  |.|.|.|        |:  |:.|.:.|||...||.|...|.|:. |.||.|..
  Fly   325 RFDN--CLKR--LNHERNHKESPVHRPHV--CSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQT 383

  Fly   412 VFVDVNYLRKHKKRIH 427
            .|...|.|..|.|..|
  Fly   384 FFNRRNALATHYKSKH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 21/77 (27%)
COG5048 220..>284 CDD:227381 15/63 (24%)
C2H2 Zn finger 223..243 CDD:275368 3/19 (16%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 7/21 (33%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368 8/20 (40%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 22/83 (27%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/21 (33%)
COG5048 <298..>383 CDD:227381 33/134 (25%)
C2H2 Zn finger 319..339 CDD:275368 10/23 (43%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
ZnF_U1 375..407 CDD:197732 10/25 (40%)
C2H2 Zn finger 378..396 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.