DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG3281

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:481 Identity:107/481 - (22%)
Similarity:177/481 - (36%) Gaps:109/481 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKNVCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGD-LLPQFICVSCVLAV 68
            :...||.|::...|.:.:...::   .::.::.|..:|...::......| .||..:|.:|...:
  Fly    11 SSQTCRVCLETHETNLYVHDEIK---YNDLKLELWQLLEAVSKLKWTWTDPNLPMHLCQNCARRL 72

  Fly    69 QNAFRFKWQSEQSYQHFFRVLNQS--GAPENQVHLAACN-GDKNQIINQKMQLKSDRQQDTQQMT 130
            ..|:.|..:.|.:::....:..|.  .|..::||:.... .|::.:::....|.:...:...:| 
  Fly    73 IGAYEFIVEVENAHETLQNLFEQQEVAAKPDEVHVDVVELIDQDDVVSMAQYLSTSFAEQHVEM- 136

  Fly   131 KTQKPDDDLSQ------KQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKM 189
            :.:..|.|.|.      ::.|.|  .|...|.|.:||.|.||.......|    :.:.:...:::
  Fly   137 EEKYGDQDCSAFTSDVGEEPLYA--SEDRDDEPEDSFQLKPRPDEIENRE----LSRPSQLGSRL 195

  Fly   190 ICDADGYYNCPHCSKRFCSQTQLRTHITD------------LCNR--------CPYCPRTYMQKS 234
            ...|:..|.|..|.:.|.....|..|.:.            |.|.        |.:||||:.::.
  Fly   196 NHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTADVAAMKLANESCGTGLLTCEHCPRTFKRQD 260

  Fly   235 NLKRHL--------------------RNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSC 279
            .|:||:                    |..::| ...|.||..:| ....|..|:|.|..|.|..|
  Fly   261 TLRRHMQAFHPDAIALEPEETTDNSARKRIAK-RRDCPHCGLSF-PVSSLTIHIRRHTGDNPYKC 323

  Fly   280 SQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPML 344
            .||...|.....|.:|.|:|   .|...||                                   
  Fly   324 DQCEKAFPRSQDLSLHMRQH---TGERPSE----------------------------------- 350

  Fly   345 KPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL-FRCEF 408
                 |.||.|||.|...|.|||..|..|... .|..||:.|.....||.|.|.|.|:. ::|..
  Fly   351 -----CKICSKKFISQNKLARHMRLHTGQRPY-SCKMCSKSFVQSNDLKIHMRRHTGERPYQCGV 409

  Fly   409 CSLVFVDVNYLRKHKKRIHSNNVIAM 434
            |...||..::|..|:.|  ..::||:
  Fly   410 CGESFVCGSHLNIHRNR--KGHLIAV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 14/77 (18%)
COG5048 220..>284 CDD:227381 24/91 (26%)
C2H2 Zn finger 223..243 CDD:275368 9/39 (23%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 11/19 (58%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368 7/20 (35%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 14/80 (18%)
C2H2 Zn finger 205..226 CDD:275368 5/20 (25%)
C2H2 Zn finger 249..266 CDD:275368 7/16 (44%)
COG5048 <294..>391 CDD:227381 38/141 (27%)
C2H2 Zn finger 296..315 CDD:275368 7/19 (37%)
zf-H2C2_2 307..330 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..358 CDD:290200 11/65 (17%)
C2H2 Zn finger 351..371 CDD:275368 11/19 (58%)
zf-H2C2_2 364..388 CDD:290200 10/24 (42%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 9/24 (38%)
C2H2 Zn finger 407..424 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.