DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG8478

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster


Alignment Length:453 Identity:85/453 - (18%)
Similarity:160/453 - (35%) Gaps:120/453 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CMDETGTL---VDIFAN-VRDPVLDEPEMSLSHI-LARCTERPVKRGDLLPQFICVSCVLAVQNA 71
            |..:..||   ||:.|| |:...|...:.::.:: |....:.|..     .|...:|..:.::|.
  Fly   150 CGGDNSTLSSSVDVTANTVKANTLKTGDATMDNVSLQEAAKTPAP-----SQVYPLSANVVLENI 209

  Fly    72 FRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPD 136
                  :|.|.:....:::.:||.:...|:.....:.:::|.:.:::.:|..:......|.:.. 
  Fly   210 ------TEVSNEGVSMLVSPAGAEKEVAHVNEVVNEVSELIAKALKISADSVKPATSKLKVEAG- 267

  Fly   137 DDLSQKQTLQAKLQEGNIDGPPESF--TLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNC 199
               .::|::.:......:..|..|:  |.....||...:::..::.|....|........|..: 
  Fly   268 ---KKRQSMSSTYSGAALPRPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRSVGGGVS- 328

  Fly   200 PHCSKRFCSQTQLRTHITDLCNRCPYCPRTYMQKSNLKRHL--------RNHLSKPA-------- 248
              .|:|.|                  .|.:.:.||::::.|        ....||||        
  Fly   329 --LSRRSC------------------LPVSKLTKSSIRKSLAVTSVRSPEKIASKPAKTSTKSIP 373

  Fly   249 ---HKCFHCSKAFMRKDHLKRHLRTHD------------SDGPLS-------CSQCSAVFIEHVQ 291
               ..|.:||..|..|..|..|:|.||            :..|::       |..|...|.....
  Fly   374 EKVFSCKNCSTTFRVKSLLDVHMRMHDPVDNGANTLKRLNSNPVAAGVSKNRCKFCDKNFALERA 438

  Fly   292 LEIHRREHKQRPGSSKSESTKDPDSDDSDQAQ----------------DLKPKWTKNTF------ 334
            |.||..::..:...|:....:..:.:...:||                ..||:...:|.      
  Fly   439 LHIHLMQNCDKIPPSEKRKLEFTELNHEKKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLAPS 503

  Fly   335 NGTCSI-PPMLK--PKPI--------------CDICQKKFSSVYALKRHMLTHNRQHHLKKCT 380
            .||.|: ||.:|  ||.:              |.||::.|.|:.....|.||.:..:.|||.|
  Fly   504 QGTQSMAPPSVKKIPKNVAHAGVYRTPTKTVPCHICKQSFRSILEFTNHSLTVHGNNQLKKMT 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 16/77 (21%)
COG5048 220..>284 CDD:227381 21/101 (21%)
C2H2 Zn finger 223..243 CDD:275368 4/27 (15%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 1/2 (50%)
C2H2 Zn finger 406..427 CDD:275368
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 8/21 (38%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..444 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.