DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG8319

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster


Alignment Length:431 Identity:104/431 - (24%)
Similarity:175/431 - (40%) Gaps:91/431 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KNVCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQN 70
            :::||.|...:..::.||.:..:..:|..:  |:.::..|.:..:...|.:||.:|:|||...:.
  Fly     2 EDLCRICGGASENMLGIFDDQVEEYVDGAK--LAEMVKTCADVQLDPDDAMPQKMCISCVHDART 64

  Fly    71 AFRFKWQSEQSYQHFF-RVLNQ---SGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTK 131
            |:.||.:.|::|:.|: .:||.   ...|..:..|...|.||.. :..|.:|..:.::..|..::
  Fly    65 AYGFKRRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENPDKGN-LEAKKKLNKEIKKTHQTASR 128

  Fly   132 TQKPDDDLS---------QKQTLQAKL------QEGNIDGPPESFTLHPRKRTCRTEEQ-----A 176
            |.|.....|         :.||.:.:|      ::.|:   .:...:|.....|:..|:     |
  Fly   129 TTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINL---LDHMKVHSNSHVCQNCEERFLFKA 190

  Fly   177 DMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQLRTH-ITDLCNR----CPYCPRTYMQKSNL 236
            |:...:..|::....:      ||.|.|.|.|...|.:| ..|:..|    ||:|.:.:.::.||
  Fly   191 DLDNHQCYRNSNSTVE------CPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNL 249

  Fly   237 KRHLRNHL-SKPA---HKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRR 297
            |.||..|. ||..   |||.:|...|..|..||.|:..|..:.|.:|..|.:.|.....|::|.|
  Fly   250 KAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIR 314

  Fly   298 EHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPI-CDICQKKFSSVY 361
            .|...                                            ||. |..|.|.||...
  Fly   315 IHTGE--------------------------------------------KPYQCPHCPKTFSDNN 335

  Fly   362 ALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGD 402
            .|.:|...|:.:... ||:.|.::|:.:.|||||..|...|
  Fly   336 NLAKHRRRHSDERPY-KCSICLQDFREKHHLKRHFLGKHRD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 20/76 (26%)
COG5048 220..>284 CDD:227381 25/71 (35%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
zf-C2H2 249..271 CDD:278523 9/21 (43%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 20/76 (26%)
COG5048 <153..368 CDD:227381 64/268 (24%)
C2H2 Zn finger 153..173 CDD:275368 2/22 (9%)
C2H2 Zn finger 179..196 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..227 CDD:275370 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..332 CDD:290200 9/67 (13%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.