DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and E(var)3-9

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_649852.2 Gene:E(var)3-9 / 41073 FlyBaseID:FBgn0260243 Length:588 Species:Drosophila melanogaster


Alignment Length:543 Identity:101/543 - (18%)
Similarity:171/543 - (31%) Gaps:185/543 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRTC-------MDETGTLV-DIFANVRDPVLDEPEMSLSHILARCTERPVK--RGDLLPQFICVS 63
            ||||       ||....:| .||.:....|.|     ::.||.:..:..:|  |.|..||::|::
  Fly    18 CRTCGIYFTMGMDMDQAIVKPIFGSDDAAVAD-----MAEILEQMNDWNIKVAREDGRPQYMCIA 77

  Fly    64 CVLAVQNAFRFKWQ--------SEQSYQ--HFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQL 118
            |:.......:||..        .|..||  |...|:.:...||.:........|.::..|     
  Fly    78 CIAEFHRLIKFKRSCVETQEQFGELEYQREHNGIVIKREIEPEEEKFCGFIYLDTDEEDN----- 137

  Fly   119 KSDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEA 183
             ||.....:.......|...:.::...:..||..:...|||     |:......:.:.|||..:|
  Fly   138 -SDEDGSRRVCAVFDIPHVPIKEEHMARVPLQNSDKFQPPE-----PKNFASPVDSRFDMIDNDA 196

  Fly   184 TRS------------------------------------------------TKMIC--------- 191
            ..|                                                :.::|         
  Fly   197 LTSGMLGPSIEDLSGTVDDGTEDEEEEEEEIVRFTYDDDNDAAAPLPPPLYSPVVCCKLCFYESP 261

  Fly   192 DADGY------------YNCPHCSKRFCSQTQ-----------LRTHITDLCNRCPYCPRTYMQK 233
            |.|.:            :.|..|.|:|.:..:           |:.|:     :||.|......|
  Fly   262 DQDAHMEHMRRTHLLKDWECHICGKKFTNAQESRIKFHIKYHKLQRHV-----KCPVCGFICSSK 321

  Fly   234 SNLKRHLRNHLSKPAH---KCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIH 295
            ..||.|     .:..|   ||.:|.|. ::...|..||:.|..:|....:| ....:|.:.:.:.
  Fly   322 ETLKEH-----KQAVHVRTKCTYCGKT-VKNATLHAHLKKHLEEGEAELAQ-QLKKLEQLPVNLQ 379

  Fly   296 RR----------------EHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSI-PPM 343
            .:                |....||    |||...||:.::.: .:....|.|..:..|.: ||.
  Fly   380 SQHLSSLESSVAEVTTASEGSNIPG----ESTVPEDSNVTENS-SVPSIETSNHADIQCPMGPPA 439

  Fly   344 LKPKP-ICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDLFRCE 407
            ....| :.|:........             ..:.||:|||:.|:..:.|:.|            
  Fly   440 NGEVPDVADVASPSTEPT-------------ESVTKCSYCSDTFEKAQQLQAH------------ 479

  Fly   408 FCSLVFVDVNYLRKHKKRIHSNN 430
                  |...:.:..|:|..|:|
  Fly   480 ------VLATHTQTRKRRRSSDN 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 25/95 (26%)
COG5048 220..>284 CDD:227381 18/66 (27%)
C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
zf-C2H2 249..271 CDD:278523 8/24 (33%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..299 CDD:275368 2/35 (6%)
C2H2 Zn finger 350..370 CDD:275368 1/19 (5%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 3/20 (15%)
E(var)3-9NP_649852.2 zf-AD 18..102 CDD:285071 22/88 (25%)
zf-C2H2_2 253..>334 CDD:289522 16/90 (18%)
C2H2 Zn finger 253..274 CDD:275368 2/20 (10%)
C2H2 Zn finger 281..303 CDD:275368 4/21 (19%)
PHA00732 310..>358 CDD:177300 16/53 (30%)
C2H2 Zn finger 311..332 CDD:275368 7/25 (28%)
C2H2 Zn finger 337..356 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8297
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.