DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG7963

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster


Alignment Length:436 Identity:101/436 - (23%)
Similarity:160/436 - (36%) Gaps:115/436 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAFR 73
            ||.|:.:...||||:     .:::|.::.|..:|..|....|.|.|:.|.::|..|...:..|.:
  Fly    10 CRVCLKQDELLVDIY-----EIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAAK 69

  Fly    74 FK---WQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKP 135
            |:   .:||:.         :..|||..:..|.....:..||       .|.....:|::..:.|
  Fly    70 FRKICVESEKL---------RDMAPEINIDTAEPLASEEIII-------IDPSDYIEQLSAVEDP 118

  Fly   136 DDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCP 200
            :::                                         |...:|           :||.
  Fly   119 ENE-----------------------------------------PIGVSR-----------WNCQ 131

  Fly   201 HCSKRFCSQTQLRTHITDL-----CNRCPYCPRTYMQKSNLKRHLRNHLSKP--AHKCFHCSKAF 258
            ||...|.....||.||.::     ...|....|.:.:....:.|..::...|  .|||..|.|..
  Fly   132 HCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCLECGKCL 196

  Fly   259 MRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQ-------RPGSSKSESTKDPDS 316
            .....|..|:|.|..:.|.:|.||:..|..:..||:|:|.|||       ..|....||      
  Fly   197 QSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVES------ 255

  Fly   317 DDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKP-ICDICQKKFSSVYALKRHMLTHNRQHHLKKCT 380
              |:..:.:..:.|:.              :| :|::.|:.||.||.|:.|:.| |.......|.
  Fly   256 --SNLRRHIVNRHTEE--------------RPHLCNVYQRSFSRVYMLELHLRT-NTGERPYACQ 303

  Fly   381 YCSEEFKTEKHLKRHERGHMGD-LFRCEFCSLVFVDVNYLRKHKKR 425
            :..:.|.....||.|||.|.|: |.||:.|...|.....||||..|
  Fly   304 HRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 21/78 (27%)
COG5048 220..>284 CDD:227381 17/65 (26%)
C2H2 Zn finger 223..243 CDD:275368 3/19 (16%)
zf-C2H2 249..271 CDD:278523 8/21 (38%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..299 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..427 CDD:275368 8/20 (40%)
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 21/74 (28%)
C2H2 Zn finger 159..179 CDD:275368 3/19 (16%)
COG5048 184..>250 CDD:227381 21/65 (32%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..262 CDD:275368 4/24 (17%)
C2H2 Zn finger 274..294 CDD:275368 9/20 (45%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..339 CDD:290200 12/23 (52%)
C2H2 Zn finger 330..350 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.