DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and Neu2

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:395 Identity:97/395 - (24%)
Similarity:146/395 - (36%) Gaps:127/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAFRFKWQSEQSYQHFFRVLNQSGAPEN 97
            ||.:|:::|:.:||...|::.|.|...||.||:...||||......|:|:| |:|.|......|:
  Fly    10 EPGLSIAYIIYKCTGWQVEKHDPLSNTICKSCLEDAQNAFDIIETYERSHQ-FYRFLKDVREEES 73

  Fly    98 QVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEG--NIDGPPES 160
            :...:.|:                                  .:.:..:..||:|  ::|...| 
  Fly    74 ENDGSGCS----------------------------------EEVEAAERDLQDGADDVDSGNE- 103

  Fly   161 FTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQLRTHITDLCNRCPY 225
                |....|      |:..||          ..|:                         .|.:
  Fly   104 ----PDINEC------DIKAKE----------KPGF-------------------------SCSH 123

  Fly   226 CPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHV 290
            ||:::..|||||.|:|:|..:....|..|.|:|.....|:.|:|||..:.|..||.|...|....
  Fly   124 CPKSFQVKSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFTAGH 188

  Fly   291 QLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPICDICQK 355
            .|:.|.:.|::| ||.:                                          |..|||
  Fly   189 HLKAHIQMHERR-GSLR------------------------------------------CPYCQK 210

  Fly   356 KFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRHERGHMGDLFRCEFCSLVFVDVNYLR 420
            .|.:...||:|:.||..:... ||:.||:.|:.|..|..|.|.|...||.|..||..|....||:
  Fly   211 CFLTSLILKQHLATHTDETQF-KCSQCSKSFQVEHELWMHMRVHQERLFTCGHCSKDFALHAYLK 274

  Fly   421 KHKKR 425
            :|..|
  Fly   275 RHLSR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 20/51 (39%)
COG5048 220..>284 CDD:227381 24/63 (38%)
C2H2 Zn finger 223..243 CDD:275368 10/19 (53%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368 8/20 (40%)
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 21/53 (40%)
COG5048 <119..241 CDD:227381 45/190 (24%)
C2H2 Zn finger 121..141 CDD:275368 10/19 (53%)
zf-H2C2_2 133..158 CDD:290200 10/24 (42%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
zf-H2C2_2 162..185 CDD:290200 9/22 (41%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
zf-C2H2_8 206..286 CDD:292531 29/75 (39%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
C2H2 Zn finger 260..297 CDD:275368 8/20 (40%)
C2H2 Zn finger 303..323 CDD:275368
C2H2 Zn finger 353..373 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.