DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG10654

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:472 Identity:100/472 - (21%)
Similarity:165/472 - (34%) Gaps:160/472 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQF----ICVSCVLAV 68
            :||.|:...|. .|...|:      :.|..|:.....||.....| ||.||.    ||..|...|
  Fly    39 ICRACLVLLGP-QDACHNL------DSEQDLASKYYGCTGEDAVR-DLPPQLVLKSICECCYQLV 95

  Fly    69 QNAFRFKWQSEQSYQHFFRVL------------------------NQSGAPENQVHLAACNGDKN 109
            |....|:....:|.::|.::|                        |:|..||.|.| |.|.....
  Fly    96 QKFHDFQRMCAESLRNFEKLLQDIDIGCHKLEDHTWHDLDTPSESNESTNPEAQSH-APCIAATQ 159

  Fly   110 QIIN--------------QKMQLKSDRQQDTQQMTKTQKPDDDLSQ-KQTLQAKLQEGNIDGPPE 159
            :|::              .::.|.:..:::. .:.:.:....||.| |.::.:||          
  Fly   160 EIVSFIWPQVCLPLAVILSRITLGASLEEEV-YVIEDESAKQDLGQEKLSISSKL---------- 213

  Fly   160 SFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQLRTHITDLCNRCP 224
               |..|||             ...|.|.                                 .|.
  Fly   214 ---LGARKR-------------RGVRHTL---------------------------------ECR 229

  Fly   225 YCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRT--HDSDGP---LSCSQCSA 284
            .|.|.:.:.|.|:.|::.|.....:.|.||:|::.|.:.|:.|||.  :::|..   .:|..|:.
  Fly   230 ICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPSCNK 294

  Fly   285 VFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKPKPI 349
            |:..:..|:.|.|...:|...|:|     ||:                              :.|
  Fly   295 VYTANRSLKYHMRRTHERYHESES-----PDA------------------------------RHI 324

  Fly   350 CDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSE-EFKTEKHLKRH---ERGHMGDLFRCEFCS 410
            |:.|.|.|:....|.||.:.|......:.|..|.: .|.|::::..|   :.|:...|.||..|.
  Fly   325 CEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLRKHGNKNLLLRCRKCG 389

  Fly   411 LVF---VDVN-YLRKHK 423
            .:|   |::| :.||||
  Fly   390 RIFQNSVELNAHGRKHK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 22/80 (28%)
COG5048 220..>284 CDD:227381 19/68 (28%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
zf-C2H2 249..271 CDD:278523 9/23 (39%)
C2H2 Zn finger 251..271 CDD:275368 9/21 (43%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 5/23 (22%)
C2H2 Zn finger 406..427 CDD:275368 9/22 (41%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 23/83 (28%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..313 CDD:275368 16/56 (29%)
C2H2 Zn finger 289..314 CDD:275368 7/24 (29%)
zf-C2H2 323..345 CDD:278523 8/21 (38%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 355..376 CDD:275368 4/20 (20%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.