DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG10543

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:416 Identity:89/416 - (21%)
Similarity:137/416 - (32%) Gaps:129/416 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QHFFRVLNQSGAPENQVHLAACN--GDKNQIINQKMQLKSDRQQDTQQMTKTQKPDD---DLSQK 142
            ||...::|....|.    |||.:  ||...:..   ||.|..:.|...::..:..||   ||.:.
  Fly   622 QHGASMMNSRQMPA----LAALSNLGDTPAMSG---QLNSSLELDDNDLSADEDDDDLDHDLDEL 679

  Fly   143 QTLQAKLQEG------NIDGPPESFTLH-----------PRKRTCRTEEQADMIPKEATRSTKMI 190
            ...:.:|.:|      ::..||..   |           |..:..:......:.|| :.|..|.:
  Fly   680 DAAKQQLIDGGSSSSTSLQAPPSQ---HGSGSGGSGGQTPGSKKDKPSYNCLLCPK-SYRKRKSL 740

  Fly   191 CD----ADGYYNCPHCSKRFCSQTQ-----LRT-HITDLCNRCPYCPRTYMQKSNLKRH------ 239
            .|    ..||  |..|.:|..:..:     .|| |:.:....|..|..:|.:|.....|      
  Fly   741 LDHYKMHPGY--CHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCETCGESYSRKQQFHAHVESHNK 803

  Fly   240 -------------------LRNHLSKPAHK-----CFHCSKAFMRKDHLKRH-LRTHDSDGPLSC 279
                               |:.|..:..||     |..|.:.|..|:.|.:| :|.|..|....|
  Fly   804 KEIKTFPCGECGLKFPQKKLQQHFEETGHKADGAICEVCGEEFQSKNALYQHIIRVHKRDNFFEC 868

  Fly   280 SQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPML 344
            ..|...|.....||.|.:.|.:                                          :
  Fly   869 HICHNRFTLKANLERHVQLHTE------------------------------------------I 891

  Fly   345 KPKPICDICQKKFSSVYALKRHMLTHNRQHHLKKCTYCSEEFKTEKHLKRH------ERGHMGDL 403
            |...:||:|...:.:..|||.|....:......|||.|.:.|.:.|.|:||      ||.|.   
  Fly   892 KRPYVCDLCGSSYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLPSHSEERPHC--- 953

  Fly   404 FRCEFCSLVFVDVNYLRKHKKRIHSN 429
              |.:|...|....:|.:||:.:|.|
  Fly   954 --CNYCDQTFKWKTHLVRHKQTMHGN 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 1/1 (100%)
COG5048 220..>284 CDD:227381 20/94 (21%)
C2H2 Zn finger 223..243 CDD:275368 6/44 (14%)
zf-C2H2 249..271 CDD:278523 9/27 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/20 (35%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 10/25 (40%)
C2H2 Zn finger 406..427 CDD:275368 6/20 (30%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 5/20 (25%)
C2H2 Zn finger 751..773 CDD:275368 5/21 (24%)
C2H2 Zn finger 781..801 CDD:275368 5/19 (26%)
PHA00733 <804..860 CDD:177301 11/55 (20%)
C2H2 Zn finger 811..827 CDD:275368 1/15 (7%)
C2H2 Zn finger 839..860 CDD:275368 7/20 (35%)
C2H2 Zn finger 868..888 CDD:275368 6/19 (32%)
C2H2 Zn finger 897..913 CDD:275368 6/15 (40%)
C2H2 Zn finger 926..946 CDD:275368 8/19 (42%)
C2H2 Zn finger 954..975 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.