DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG30431

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:483 Identity:102/483 - (21%)
Similarity:163/483 - (33%) Gaps:141/483 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCRTCMDETGTLVDIFANVRDPVLDE-----PEMSLSHILARCTERPVKRGDLLPQFICVSCVLA 67
            |||.|:.|...|.....:....:..|     |.:.|.|            ||.|...||..|:..
  Fly    11 VCRCCLLEQPPLYHSLYDASSQLAVELKALAPALRLEH------------GDNLTDVICDLCLRR 63

  Fly    68 VQNAFRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDK---NQIIN------------QKMQ 117
            :.:|..|:.:.|.|.|    ||..  ..|:..|..|. ||.   :.::.            ..:.
  Fly    64 LHDARDFQRRCEHSEQ----VLRM--RHEHWKHTVAV-GDALALDDVLECLEREVGSLEGPMSVP 121

  Fly   118 LKSDRQ-------QDTQQMTKTQKPDDDLSQKQT---LQAKLQEGNIDGP---PESFTL------ 163
            |::.:.       .:|.........|...|:...   .::.:..|:::.|   ||:..|      
  Fly   122 LQASKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPP 186

  Fly   164 ---------------HPRKRTCRTEEQADMIPKEATRSTKMICDADGYYNCPHCSKRFCSQTQLR 213
                           .|:.|..| ..|.::.|||  |...........:.||.|.|:|....||:
  Fly   187 TPPESSEEPAPDAAEKPKMRRAR-PRQDNVKPKE--RKASGAVHPRSLHPCPECEKKFTRNFQLK 248

  Fly   214 THITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRT-HDSDGPL 277
            .|:|.:                      :.:.:..::|..|.|.|..:..|:.|::: |.::.|.
  Fly   249 LHMTAV----------------------HGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPF 291

  Fly   278 SCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPP 342
            .|..|...||...||..|.|.|                      ..:.||:..:           
  Fly   292 GCQHCDRRFILRTQLLSHLRTH----------------------TGEAKPRIFE----------- 323

  Fly   343 MLKPKPICDICQKKFSSVYALKRHMLTHN-RQHHLKKCTYCSEEFKTEKHLKRHERGHMGDL-FR 405
                   |..|.|.:.:...|:.||.:|| ......||..||:.|.|..||..|...|.|:. |.
  Fly   324 -------CQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFA 381

  Fly   406 CEFCSLVFVDVNYLRKHKKRIHSNNVIA 433
            ||:|...:..|..|..|..|:|::.:.|
  Fly   382 CEYCDKCYQSVGNLNNHMVRLHADIIEA 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 21/81 (26%)
COG5048 220..>284 CDD:227381 10/64 (16%)
C2H2 Zn finger 223..243 CDD:275368 0/19 (0%)
zf-C2H2 249..271 CDD:278523 6/22 (27%)
C2H2 Zn finger 251..271 CDD:275368 6/20 (30%)
C2H2 Zn finger 279..299 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368 7/20 (35%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 22/86 (26%)
C2H2 Zn finger 234..255 CDD:275368 9/42 (21%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 24/107 (22%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
zf-H2C2_2 366..389 CDD:290200 9/22 (41%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.