DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG4496

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:372 Identity:79/372 - (21%)
Similarity:132/372 - (35%) Gaps:116/372 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HILARCTERPV-------------------KRGDLLPQFICVSCVLAVQNAFRFKWQSEQSYQHF 85
            |::....|||.                   :|....|||||:.|.|                   
  Fly   263 HMMIHTGERPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHL------------------- 308

  Fly    86 FRVLNQSGAP--ENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPDDDLSQKQTLQAK 148
                   |||  ::....|.|. .||.::  |.|.:...::.|::.:...:.|||..::..|:.:
  Fly   309 -------GAPLEQDSTRCADCE-SKNLMV--KPQPEELGEKTTEEHSDEMEGDDDEIEEAALENE 363

  Fly   149 LQE-------------GNIDGPPESFTLH------PRKRTCRTEEQADMIPKEATRSTKMICDAD 194
            .|.             ..|..|||....|      |..|:|.:...:..:..:...:.|.:    
  Fly   364 KQPQVATQPSLMVTLIPPIQSPPEKVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSM---- 424

  Fly   195 GYYNCPHCSKRFCSQTQLRTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFM 259
                         |:|: |::      .||.|.|.:..:.|||||...|..:....|..|.|.|.
  Fly   425 -------------SRTR-RSY------PCPLCHRPFGTRHNLKRHYMIHTGEKPFSCSKCRKPFR 469

  Fly   260 RKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQD 324
            ....||:|:.||..|....|.:|.:.|.::::...|:..|:.:..|.||...:..|..||     
  Fly   470 ECSTLKKHMVTHVRDRWYKCLRCPSKFRDYLEYSDHKNNHQDQLSSRKSSIYESDDDGDS----- 529

  Fly   325 LKPKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHN 371
                          |:...|:    |..||::|:.:.|...|:..|:
  Fly   530 --------------SVEDCLE----CCECQQRFTELDAYTAHLKKHD 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 12/63 (19%)
COG5048 220..>284 CDD:227381 22/63 (35%)
C2H2 Zn finger 223..243 CDD:275368 9/19 (47%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
C2H2 Zn finger 279..299 CDD:275368 4/19 (21%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368
C2H2 Zn finger 406..427 CDD:275368
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 1/3 (33%)
C2H2 Zn finger 247..267 CDD:275368 1/3 (33%)
zf-H2C2_2 259..282 CDD:290200 4/18 (22%)
C2H2 Zn finger 275..295 CDD:275368 0/19 (0%)
zf-C2H2 431..453 CDD:278523 9/27 (33%)
C2H2 Zn finger 433..453 CDD:275368 9/19 (47%)
zf-H2C2_2 445..468 CDD:290200 9/22 (41%)
C2H2 Zn finger 461..481 CDD:275368 7/19 (37%)
C2H2 Zn finger 489..510 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.