DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG15436

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:430 Identity:110/430 - (25%)
Similarity:177/430 - (41%) Gaps:98/430 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAF 72
            :||.|||.:|.||:||...|     ...:|::.::|:||...||||||..:.||..|...|::|:
  Fly     4 ICRVCMDISGKLVNIFDARR-----RTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAY 63

  Fly    73 RFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKPDD 137
            ..:...|:|:|.:.||.::.      :..|.|    ..:..:..::..|   :..::......||
  Fly    64 GIRQTCEESHQFYCRVRDEG------IEDALC----ALLEEEDWEISED---EDARIDSASAADD 115

  Fly   138 DLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMICDADGY-YNCPH 201
            |             |..|....:|..    |.|..:.|     ::.|....|....||. :.||:
  Fly   116 D-------------GKSDSKKVAFEC----RECHKKYQ-----RKGTFLRHMRTHMDGQSFPCPY 158

  Fly   202 CSKRF----CSQTQLRTHITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKD 262
            |.:.|    ..:..::||.......|.:|.:|:.|:|.|:.|.|.|..:...||..|||.|::..
  Fly   159 CKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSS 223

  Fly   263 HLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRREHK-QRPGSSKSESTKDPDSDDSDQAQDLK 326
            .|:||:|||.|:.|..||:|:..|.....|:.|.|.|. :||..                     
  Fly   224 DLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFK--------------------- 267

  Fly   327 PKWTKNTFNGTCSIPPMLKPKPICDICQKKFSSVYALKRHMLTHNRQH---HLKKCTYCSEEFKT 388
                                   |..|.|.|    |:|:|:..|:|.|   ...:|::|.:.|:.
  Fly   268 -----------------------CSHCPKAF----AMKQHLKQHSRLHLPDRPFRCSHCPKTFRL 305

  Fly   389 EKHLKRHERGHMGD-LFRCEFCSLVFVDVNYLRKHKKRIH 427
            ...||.|:..|..: .|:|..|:..:.....|.:|...||
  Fly   306 SSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 29/76 (38%)
COG5048 220..>284 CDD:227381 26/63 (41%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
zf-C2H2 249..271 CDD:278523 10/21 (48%)
C2H2 Zn finger 251..271 CDD:275368 9/19 (47%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 4/20 (20%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 29/78 (37%)
C2H2 Zn finger 128..148 CDD:275368 5/28 (18%)
C2H2 Zn finger 156..176 CDD:275368 4/19 (21%)
COG5048 <180..341 CDD:227381 54/208 (26%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 9/21 (43%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 7/19 (37%)
zf-H2C2_2 252..276 CDD:290200 10/71 (14%)
C2H2 Zn finger 268..288 CDD:275368 9/23 (39%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
C2H2 Zn finger 324..341 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.