DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG17612

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:469 Identity:115/469 - (24%)
Similarity:175/469 - (37%) Gaps:126/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPVKRGDLLPQFICVSCVLAVQNAFR 73
            ||.|::::..|.:||.:..     :..:.::.||::.|..||::||...::|||:|:..|:|||.
  Fly   187 CRVCLEQSDNLTNIFDDAH-----QYGIPIATILSQYTGMPVEKGDSFSEYICVTCLDVVKNAFD 246

  Fly    74 FKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQMTKTQKP-DD 137
            .....|.:.|.:                   ...|.:||            |...:....|| |.
  Fly   247 DLESKENTIQMY-------------------RQPKEEII------------DIDSIPVKNKPVDY 280

  Fly   138 DLSQKQ-----------TLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPK--------EA 183
            :::.|.           .|.|||| .:|....|:.|..|.:..|      .|.|.        ||
  Fly   281 EVTGKPPHRCPQCPKIFLLAAKLQ-AHIRTHNETRTTEPPRLKC------PMCPSIYMKRGCLEA 338

  Fly   184 -----TRSTKMICDADGYYNCPHCSKRFCSQTQLRTHI---TDLCNR--------CPYCPRTYMQ 232
                 ..|.:...:.:..|.||||.|.|...:.|..||   .|:..|        |..|...:..
  Fly   339 HMWIHRASDERESELEPPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSD 403

  Fly   233 KSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLSCSQCSAVFIEHVQLEIHRR 297
            .|:||.|::.|..:...||..|..:|..:.:||.|...|..   ..|.:||..|.....|:.|.:
  Fly   404 VSSLKDHVKIHAGERTFKCPLCLMSFQEESNLKSHDCAHTR---FKCHKCSKFFESQNYLDFHFK 465

  Fly   298 EHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNG--------TC------SIPPMLKPKP 348
                     ||.:||.|       .:.:|.:.|....||        .|      ..|..:.|  
  Fly   466 ---------KSHTTKGP-------FKCIKCQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFP-- 512

  Fly   349 ICDICQKKFSSVYALKRHMLTHNR-----QHHLKKCTYCSEEFKTEKHLKRHERGHMGDLFRCEF 408
             |..|.||||.....:.|..||.:     :.|  .||.|.:.::.:|.|.:|...|.    ||..
  Fly   513 -CPKCPKKFSIEDNYQMHHATHKKVKTVIERH--NCTQCKKSYQNKKLLTKHILSHN----RCVH 570

  Fly   409 CSLVFVDVNYLRKH 422
            ||:.|.....|.:|
  Fly   571 CSMSFTSKYLLEQH 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 23/75 (31%)
COG5048 220..>284 CDD:227381 18/71 (25%)
C2H2 Zn finger 223..243 CDD:275368 6/19 (32%)
zf-C2H2 249..271 CDD:278523 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..299 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..427 CDD:275368 6/17 (35%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 20/63 (32%)
C2H2 Zn finger 290..310 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275370 5/25 (20%)
zf-C2H2_8 356..438 CDD:292531 25/81 (31%)
C2H2 Zn finger 359..379 CDD:275368 9/19 (47%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
C2H2 Zn finger 422..438 CDD:275368 5/15 (33%)
C2H2 Zn finger 447..463 CDD:275368 5/15 (33%)
C2H2 Zn finger 476..505 CDD:275368 5/28 (18%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
C2H2 Zn finger 545..565 CDD:275368 6/19 (32%)
C2H2 Zn finger 568..584 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006715
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.