DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2678 and CG9609

DIOPT Version :9

Sequence 1:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:345 Identity:83/345 - (24%)
Similarity:129/345 - (37%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QLKSDRQQDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPK 181
            |:.||...:|..        ::..|:|.     :..:|.....:.::...:.|.:..:|.|....
  Fly     6 QIASDSDMETAL--------EEFKQRQG-----RRNSIGSAKYACSMPKCEATFKRLDQLDRHEY 57

  Fly   182 EATRSTKMICDADGYYNCPHCSKRFCSQTQLRTHITDLCNR----------CPY--CPRTYMQKS 234
            ..|...|..|..:|      |.|.:...|.|:.|:.....|          |..  |.:.::..|
  Fly    58 HHTGIKKHACSYEG------CDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVS 116

  Fly   235 NLKRHLR-NHLSKPAHKCFHCSKAFMRKDHLKRH-LRTHDSDGPLSCSQCSAVFIEHVQLEIHRR 297
            |:.||:| .|.|...:.|..||..|.:|..|||| :|.|..:.|.|||:||..|.:..|.:.|  
  Fly   117 NMTRHMRETHESPKVYPCSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQWQCQSH-- 179

  Fly   298 EHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWT------KNTFNGTCSIPPMLKPKPICDICQKK 356
                .|.....|....|...|         |||      :::.:|        |.:..||.|...
  Fly   180 ----EPSCKLYECPGCPLQFD---------KWTLYTKHCRDSLHG--------KNRHKCDRCDSA 223

  Fly   357 FSSVYALKRHM-LTHNRQHHLKKCT---YCSEE-----FKTEKHLKRHE-RGHMGDLFRCEF--C 409
            |.....||||: :.|.......:|.   .|:||     :...::|::|. ..|.|..|.|:.  |
  Fly   224 FDKPSELKRHLEVKHKEAAQTDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDC 288

  Fly   410 SLVFVDVNYLRKHKKRIHSN 429
            ...|.....|.:|..|.|.:
  Fly   289 GRCFSSAQNLARHLLRDHKD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2678NP_649750.1 zf-AD 8..85 CDD:214871
COG5048 220..>284 CDD:227381 26/77 (34%)
C2H2 Zn finger 223..243 CDD:275368 7/22 (32%)
zf-C2H2 249..271 CDD:278523 10/22 (45%)
C2H2 Zn finger 251..271 CDD:275368 10/20 (50%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/20 (40%)
C2H2 Zn finger 379..399 CDD:275368 6/28 (21%)
C2H2 Zn finger 406..427 CDD:275368 6/22 (27%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 3/18 (17%)
zf-C2H2_8 67..150 CDD:292531 24/88 (27%)
C2H2 Zn finger 67..90 CDD:275368 7/28 (25%)
C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
C2H2 Zn finger 134..155 CDD:275368 10/20 (50%)
C2H2 Zn finger 188..210 CDD:275368 5/30 (17%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 253..276 CDD:275368 5/22 (23%)
C2H2 Zn finger 283..302 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.